SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091009903m|PACid:23558966 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091009903m|PACid:23558966
Domain Number 1 Region: 192-488
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 3.14e-98
Family Cryptochrome/photolyase FAD-binding domain 0.0000000000382
Further Details:      
 
Domain Number 2 Region: 7-178
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.7e-50
Family Cryptochrome/photolyase, N-terminal domain 0.0000000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091009903m|PACid:23558966
Sequence length 682
Sequence
MSGGGCSIVWFRRDLRVEDNPALAAGVRAGAVIAVFIWAPEEEGQYYPGRVSRWWLKQSL
AHLDSSLRSLGTPLITKRSTNSVSSLLEVIKSTGATQLFFNHLYDPLSLVRDHRTKEVLT
AQGITVRSFNSDLLYEPWDVNDAHGQPFTTFSAFWERCLSMPYDPQAPLLPPKRIIPGDA
SRCPCDTLVFEDELEKASNALLSRAWSPGWSNADKALAAFVNGPLIEYSKNRRKADSATT
SFLSPHLHFGEVSVKKVFHLVRIKQVFWANEGNKAGEESVNLFLKSIGLREYSRYISFNH
PYSHERPLLGHLKFFPWVVNEGYFKAWRQGRTGYPLVDAGMRELWATGWLHDRIRVVVSS
FFVKVLQLPWRWGMKYFWDTLLDADLESDALGWQYISGTLPDGREFDRIDNPQFEGYKCD
PNGEYVRRWLPELARLPTEWIHHPWNAPEYVLQAAGIELGSNYPLPIVGIDAAKVRLQEA
LIQTWQQEAASRAAIENGTEEGLGDSSESAPIAFPQDTLMEERPAEPVRNNPPHGTRRYE
DQMVPSMTSSHVRVEEEETSSDLRNSAADNRAEVPTNVTTQQNARETVNQGELLNVNRNT
RVQNNATMWLRNAAEDSTAESSISTRRERDGGVVPVWSPPASNFSEQYADDENGIGASSS
YLQRQHPQSHQLMNWTRLPQTG
Download sequence
Identical sequences V7B5W0
Phvulv091009903m|PACid:23558966 XP_007141180.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]