SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091010322m|PACid:23557111 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091010322m|PACid:23557111
Domain Number 1 Region: 192-487
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.7e-100
Family Cryptochrome/photolyase FAD-binding domain 0.000000000777
Further Details:      
 
Domain Number 2 Region: 3-178
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 3.01e-51
Family Cryptochrome/photolyase, N-terminal domain 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091010322m|PACid:23557111
Sequence length 635
Sequence
MGSNRTIVWFRRDLRIEDNPALAAAAREGSVLPVYIWCPKEEGQFYPGRVSRWWLKQSLA
HLDRSLKSLGTRLVLIKTHSTVTALLECIKAIQATKVVFNHLYDPVSLVRDHNIKEKLVE
QGISVQSYNGDLLYEPWELYTESGRAFTTFNAFWTKCLHKQMDIVSLVPPWQLTPAEGKV
EDCSVEELGLENELEKPSNALLGRAWSPGWRNADKALTEFVEQHLLHYSKKRLKVGGDST
SLLSPYLHFGELSVRKVFQVTRMKQILWTNEGNSVGEESVNVFLRAIGLREYSRYLCFNF
PFTHERALLGHLKFFPWNPDPDKFKTWRQGRTGYPLVDAGMRELWATGWIHSRIRVIVSS
FAVKMLLLPWKWGMKYFWDTLLDADLESDILGWQYISGGLPDGHELERLDNPEILGAKFD
PEGDYVRQWLPELARMPTEWIHHPWDAPLTVLRASGVELGQNYPKPMIDVDLAREKLTEA
IFKMWESEAAAKAAGSEPRDEVVVDNTNSGENLDTPKVVFLEKAPCATVSANDQKVPALP
DSKKDHPPTRKRPNCMVEEGQNQGNSQNHNKDTGMSSVDQDICSTADSSSCKKQCASTSS
YSFSVPQQCSSSSNLKWPWQEQIDMEQSSSKDGAV
Download sequence
Identical sequences V7BDG0
Phvulv091010322m|PACid:23557111 Phvulv091010323m|PACid:23557112 XP_007143870.1.22112 XP_007143871.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]