SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091010325m|PACid:23557114 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091010325m|PACid:23557114
Domain Number 1 Region: 192-487
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.7e-100
Family Cryptochrome/photolyase FAD-binding domain 0.000000000777
Further Details:      
 
Domain Number 2 Region: 3-178
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 3.01e-51
Family Cryptochrome/photolyase, N-terminal domain 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091010325m|PACid:23557114
Sequence length 633
Sequence
MGSNRTIVWFRRDLRIEDNPALAAAAREGSVLPVYIWCPKEEGQFYPGRVSRWWLKQSLA
HLDRSLKSLGTRLVLIKTHSTVTALLECIKAIQATKVVFNHLYDPVSLVRDHNIKEKLVE
QGISVQSYNGDLLYEPWELYTESGRAFTTFNAFWTKCLHKQMDIVSLVPPWQLTPAEGKV
EDCSVEELGLENELEKPSNALLGRAWSPGWRNADKALTEFVEQHLLHYSKKRLKVGGDST
SLLSPYLHFGELSVRKVFQVTRMKQILWTNEGNSVGEESVNVFLRAIGLREYSRYLCFNF
PFTHERALLGHLKFFPWNPDPDKFKTWRQGRTGYPLVDAGMRELWATGWIHSRIRVIVSS
FAVKMLLLPWKWGMKYFWDTLLDADLESDILGWQYISGGLPDGHELERLDNPEILGAKFD
PEGDYVRQWLPELARMPTEWIHHPWDAPLTVLRASGVELGQNYPKPMIDVDLAREKLTEA
IFKMWESEAAAKAAGSEPRDEVVVDNTNSGENLDTPKVVFLEKAPCATVSANDQKVPALP
DSKKDHPPTRKRPNCMVEEGQNQGNSQNHNKDTGMSSVDQDICSTADSSSCKKQCASTSS
YSFSVPQQCSSSSNLKWPWQEQIDMEQSSSKDV
Download sequence
Identical sequences Phvulv091010324m|PACid:23557113 Phvulv091010325m|PACid:23557114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]