SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091010915m|PACid:23548859 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091010915m|PACid:23548859
Domain Number 1 Region: 467-568
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.94e-23
Family B3 DNA binding domain 0.007
Further Details:      
 
Domain Number 2 Region: 247-348
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-22
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 3 Region: 19-112
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-22
Family B3 DNA binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091010915m|PACid:23548859
Sequence length 593
Sequence
MGCDCGGKLNLRKPHFYEVFSSAFSSHRLKIPDGFVCRMEGRTYGSLSLIGPSGNVWTVQ
LLKQDNDLFFHHGWSSFVVDHSLECGDLLVFRYEGHLHFTVQVFDKDACEKEAAFISECS
QSSSDFEAITGQKRGTKESSSLDIAFDGVSKKMRGCKYENQEHEPGFVGKDLLRYEVVRP
IRMFRETEETSKACLANDALVPFHTDNRNEEAAIMYRSGKEDGSYFLGGVSLSNVSAQDE
KKVAQSFTSDYPYFVRIMKSFNVSGSYTLNIPYQFSMAHLPNCKIKIILHNLKGEHWTVN
SVPTTRVHTSHTLCGGWMAFVRGNSITVGDICIFELVHKCELRVHIAGVGNDGLDCQVGR
VNAGHVGPPRYMPTNAKVNSKCIRKVDVSNKKWPKIGQETVLSIDLKKSGRASNASKHMG
LCPQSKVAHKKLATPRRHRVEDELSSQAKAGLRMLFALDEQRVAQAFSSPFPSFVKIMKK
FNVSGSYTLKIPYQFSAAHLPTYKTEVILRNSRGECWTVNSVPDAKGRTVHTFCGGWMAF
VRDNDINFGDTCIFELVTQSEMQVYISGVGKEGPDHQNGHIKLDRLANLPSTC
Download sequence
Identical sequences V7CV77
XP_007160811.1.22112 XP_007160812.1.22112 Phvulv091010915m|PACid:23548859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]