SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091012922m|PACid:23533246 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091012922m|PACid:23533246
Domain Number 1 Region: 609-840
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000915
Family Tropomyosin 0.0021
Further Details:      
 
Domain Number 2 Region: 441-617
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000981
Family Tropomyosin 0.001
Further Details:      
 
Weak hits

Sequence:  Phvulv091012922m|PACid:23533246
Domain Number - Region: 263-461
Classification Level Classification E-value
Superfamily Tropomyosin 0.00785
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number - Region: 886-984
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0112
Family Myosin rod fragments 0.0053
Further Details:      
 
Domain Number - Region: 46-273
Classification Level Classification E-value
Superfamily Tropomyosin 0.0294
Family Tropomyosin 0.00067
Further Details:      
 
Domain Number - Region: 1058-1162
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0314
Family Myosin rod fragments 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091012922m|PACid:23533246
Sequence length 1357
Sequence
MEEETKVISEVPGTKVVVEADHNNDSIKETNGGLPSEVKKEEEDSALDGEFIKVEKEENA
IDDKSHKTERSSDSPSREFLEAQEKIQELDVELQRLTESLKTSEHENNHLRGEISVTKEK
LEESGKKYEELELSHKKLQEQVVEAENKYNQQLSNLEEALQSQEVKQKELLNVKEKFDDI
SLELEHSRKKMQELHDELKLSADEARKFEELHKQSGSHAESEGKKVLEFERLLEEAKLTA
KGMEDEMASLKEELKGVYDKISENQKIEEALKTTTAELSTIQEELTLSKSQLLEVEKRLS
SRDSLVDELTQEVNLIKTSETQLKEDVSVFQNLLASTKEELQEKKFELETARSKLLEEEK
LKESIEVALKNQETQFLNVQEELIKLKTENGTLESTLEDVTLNSKKFEELCTDLEERLKL
SDENFLKTDFLLSQALSNNAELELKVKSLEDLHNESGAAAATATQRSLELEGHIQTSVEA
AEVAKTQLRDLETRFIAAEQKNVELEQQLNLLQLKTSDADREVTELSEKISHLNAKLEED
KEEKNRINGQLQEYMEKVVQLESDLNKSSLRSSQLEEELKIVNDKCSEHEDRASMNHQRS
RELEDLFQSSHSKLEDSDKKVSELELLLEAEKYRIQELEQQISALEDKCSVSEAQANKYL
NDVSNLTSELEAVQARTSTLEITLQAANERGKELEDSLNAITDEKKKLEDASSSLNEQLA
EKENLVEILRDDLNLTQGKLQSTESDLRAAELRESDIIEKLKASEENVIIRGRDIEETAT
RHSELQLLHESLTRDSEQKLQEAIEKFSKKDSEVHSLLEKIKILEEQIALDGEQSTTLKN
EFEESLSKLAALESENEDLKRKILEAESKSSQSFSENELLVGTNIELRTKIDELEESLNR
ALSEKDVTTQELESHKNSIAELNDLQSKSTKIHSANESRILEVESQLQEALQRHTEKESE
SKELNEKLNTLEGQIKLFEEQAREAVATSGTQKAELEESLIKLKHLETVIEELQSKSLHH
EKETSGLNDENSKLNQEIAIYESKLSDLKSELSAALAEKDETVKEILTSKNAIEELVTKH
SAEVQTLNSQLSSVIDEKNLLNETNQDIKKELQSLILDLEEKLKEQQKIEGSLRSEIETL
KIEIAEKSVLQRQLEEIEGQLTKSASRLNEEVGSVQAAASQREAELNSKLVDYEQKFNDR
NVLNEKVAELEKELQLARDALANQKGAESQKLELETALKNSVEELEIKKKDISLLQKQVA
DLEQKLQLASDKSSVKGDEGVDKKEGLEVKSRDIGSSLSTPSKRKSKKKSEVPSAQTSSS
SETNVQSGQDSPVINLKFILGVALVSIVFGIILGKRY
Download sequence
Identical sequences V7AFE7
Phvulv091012922m|PACid:23533246 Phvulv091012923m|PACid:23533247 XP_007131574.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]