SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091016542m|PACid:23539065 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091016542m|PACid:23539065
Domain Number 1 Region: 455-475,530-571,601-787
Classification Level Classification E-value
Superfamily HAD-like 4.41e-38
Family Meta-cation ATPase, catalytic domain P 0.0029
Further Details:      
 
Domain Number 2 Region: 265-350
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.66e-16
Family Calcium ATPase, transduction domain A 0.007
Further Details:      
 
Domain Number 3 Region: 193-245,352-451,479-497
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000248
Family Calcium ATPase, transmembrane domain M 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091016542m|PACid:23539065
Sequence length 826
Sequence
METLPYTIPSTKLHSLRIYTRATPIPFSTLPFRPPGISIKPLYSPKFLILPPRRYRCVAD
SSNNHHHHDHQGHHHHHDHQDHQGHHHHHHHHHHHHSHGIDGANLTGPQKAVIAFAKATR
WMDLADILREHLHLCCFSTVLFVAAAICPHTLPKPLVRPFQNSLIFIAFPLVGVSASLDA
LIEISSGKVNIHVLMAMAAFASIFMGNSLEGGLLLAMFNLAHIAEEHFTSRSMVDVRELK
ENNPDFALVLDTKDDKLPNTFDLAYKRIPVHDVTVGSYILVGAGESVPVDCEVFQGNATI
TIEHLTGEVKPLEAKVGDRIPGGARNLDGRIIVKVTKTWKESTLSKIVQLTEEAQSNKPK
LQRWLDEFGERYSQVVVVLSIAIAVIGPLLFKWPFISTSACRGSIYRALGLMVAASPCAL
AVAPLAYAIAISSCAKKGILLKGGHVLDALASCRTIAFDKTGTLTTGGLVFKAIEPIYGH
HVRNNVSKFSSCCIPTCEKEALAVAAAMEKGTTHPIGRAVVDHSEGKDLPSISVESFEYF
PGRGLTATVNNIESGRESAKLLKASLGSIDFITSFCQSEDESEKIKEAVNTSSYGSEYVH
AALSVNQKVTLIHLEDRPRPGVFNVIQELQDEAKFRVMMLTGDHESSARRVASAVGINEF
HCNLKPEDKLSHVKDTSRDMGGGLIMVGEGINDAPALAAATVGIVLAHRASATAIAVADI
LLLRENISAVPFCIAKSRQTTSLIKQNVALALTSIVMASLPSVLGFLPLWLTVLLHEGGT
LLVCLNSVRALNEPSWSWKHDILHLISQIKSSLLSLKQISRAQTVS
Download sequence
Identical sequences V7CF31
XP_007155886.1.22112 Phvulv091016542m|PACid:23539065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]