SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091021639m|PACid:23559294 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091021639m|PACid:23559294
Domain Number 1 Region: 193-455
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.09e-82
Family Cryptochrome/photolyase FAD-binding domain 0.00000000333
Further Details:      
 
Domain Number 2 Region: 6-173
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 2.88e-51
Family Cryptochrome/photolyase, N-terminal domain 0.00000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Phvulv091021639m|PACid:23559294
Sequence length 598
Sequence
MGRSKTIVWFRRDLRIEDNPALAAAAREGSVFPVYIWCPKDEGQFYPGRVSRWWLKQSLA
QLDNSLKSLGAELVLIKTDSTLEALLECANAIQATKVVFNHLYDPVSLVRDHSIKEKLVE
HGIKVQSYNGDLLFEPWNIYDESGHAFTAFDPFWNKCLHMQMQAISSIPSCQLILAEGKV
GKSSIEQLGLEDESEKSSNALLGRAWCPGWSKTDKALTEFVEHHLLHYSKNRLKILWANE
GNSAGEESVTLFLRAIGLREYSRYLCFNFPFTLEKPLLGNLTYFPWETDPANFKAWRQGR
TGYPLVDAGMRELWATGWIHNKIRVIVSSFAVKMLLIPWRWGMKYFWDTLLDADLESDIL
GWQYISGCLPDGHKLERLDDPAIHGAKFDPEGEYVRQWLPELARMPAEWIHHPWNAPFTV
LRASGVELGENYPKPIIDIDMARQQLTEAIFKMWENEAASKGSGSEGGHEVVDESENLAI
PKVFLKDKAPPATSSSNDQKVPTLHHPQSDPPSRKRLKCMAEINQKQNGSQNLSKDTGVS
GIDREVSSTAESSCMRQSSSTYSFSVPQQCSSSSNMRCSWQDQLDMETSSSKDGAMGG
Download sequence
Identical sequences V7BLD6
Phvulv091021639m|PACid:23559294 XP_007145848.1.22112 XP_007145849.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]