SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091025782m|PACid:23542283 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091025782m|PACid:23542283
Domain Number 1 Region: 216-519
Classification Level Classification E-value
Superfamily SPOC domain-like 9.42e-78
Family Ku80 subunit middle domain 0.0011
Further Details:      
 
Domain Number 2 Region: 552-683
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 9.81e-46
Family C-terminal domain of Ku80 0.00035
Further Details:      
 
Domain Number 3 Region: 5-227
Classification Level Classification E-value
Superfamily vWA-like 1.27e-32
Family Ku80 subunit N-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091025782m|PACid:23542283
Sequence length 686
Sequence
MPPIKDALLLLLDVGPSMHYVLPEIEKACSLLVQKKLVFSKNDEVGIVLFGTEDTDNELT
TEVGGYQHVVVLKNTKVVDGDIVEALQHLPRGTTDGDFVDAVIVGMNLLIKKFGQTNKGK
KRICLITNAQCPIKESYEGTKEEQVTTIAKQLTAHGMKMESIIVRGKLSQDANKGIMDEN
DRLLNIFSKETSTRLLYLENPISLFGALKTRNITLVTVFRGDLEISPKLSIKVMVYKKTA
EEKFPTLKKYTDKAPPNDKFATREVKIDYEYKSSEDPDKVVVPPDQRIRGYPYGPQIVPL
STSHWDAFKFLPEKGVKLLGFTDSSNVFRHHYMKDVYVFLPQPGNTRAMLAVSSLARAMK
EMDKVAILRCVWRQGQANVVIGVLTPNLSDKENIPDSFYLNVLPFAEDVREFQFHSFSNF
PASWLPNGQQLEAAANLVKALDLAPDGQEEVLLPDFTANPVLERFYRFLEQKSKDPDIAV
PPLDDTLKKITEPDADLLLQNKSVIDSFCRSFELKGNPLKKSRRLFGGKRSFSNDEEIKE
NITAEPPNLIENASVKVEKIGDLTPAQDFEALISRRDSPDWVVKAINEMKNKIFDLVEDS
HEGDNYPKALECLVVLRKGCILEQEPKQFNDFLKHLCNFCQEKSLHSFCQYLASKDLTLI
SKTEAVDSDVTDEEARSFLVKSEPKS
Download sequence
Identical sequences Q8S562
Phvulv091025782m|PACid:23542283 XP_007159070.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]