SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091026608m|PACid:23546827 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091026608m|PACid:23546827
Domain Number 1 Region: 195-479
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 6.67e-89
Family Cryptochrome/photolyase FAD-binding domain 0.0000000000688
Further Details:      
 
Domain Number 2 Region: 8-179
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 5.1e-48
Family Cryptochrome/photolyase, N-terminal domain 0.0000000839
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091026608m|PACid:23546827
Sequence length 664
Sequence
MRGGGGCSIVWFRRDLRVEDNPALTAGVRAGAVVAVFIWAPEEEGQYYPGRVSRWWLKQS
LAHLDSSLRNLGTRLITKRSTDTVSSLLEVLKFTGATQLYFNHLYDPLSLVKDHRVKEVL
NAKGITVRSFNADLLYEPWDVNDVHARPFTTFAAFWDRCLNMPYDPDSPLLPPKRIIPGD
VSRCPSDRLVFEDESEKASNALLARAWSPGWSNANKALTAFINGPLIEYSTNCRKADSAT
TSLLSPHLHFGELSVKKVFHLVRIKQLLWANEGNKASEESVNLFLKSIGLREYSRYISFH
HPYSHERPLLGHLKFFPWVVNEAYFKAWRQGRTGYPLVDAGMRELWATGWLHDRILLQLP
WRWGMKYFWDTLLDADLESDALGWQYITGTLPDGREFDRIDHPQFEGYKFDPNGEYVRRW
LPELARLPTEWIHHPWNAPESVLQAAGIELGSNYPLPIVGIDAAKTRLQEALSEMWQLEA
TSRAEVENGTEEGLGESSESIPAAFAQDTQMEETHEPVRNNPLPVARSFLDQMVPSITST
LLRVEDEETTSDLRNSAEESSAAEVPINVNAQQNAGGVTWNERILQSAHRNTQVQYNTTM
ELRNVAEDSAVESSSGTRRERDGGSVPVWSPPASSDSEQFVGDENGITNLFLAKASSVSP
ITEL
Download sequence
Identical sequences Phvulv091026608m|PACid:23546827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]