SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091028929m|PACid:23546064 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091028929m|PACid:23546064
Domain Number 1 Region: 208-497
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 1.96e-96
Family Cryptochrome/photolyase FAD-binding domain 0.00000902
Further Details:      
 
Domain Number 2 Region: 7-187
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 2.75e-44
Family Cryptochrome/photolyase, N-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091028929m|PACid:23546064
Sequence length 536
Sequence
MMGSGSGSLVWFRKGIRIHDNPALEFASRSASHLYPVFVIDPHYMKPDPNAPSPGSSRAG
LNRIKFLLESLVDLDLNLKNLGSRLLILKGDPAEVVIQCLKEWNVNKLCFEYDTDPYYQA
LDVKVKNFALGAGIEVFSPVSHTLFNPTDIIHKNGGKPPLSYQSFVKLAGEPPFPLTTMY
SSLPPVGHLGSCVISEVPTITDLGYGDAEQDEFSPFKGGESEALRRLDECMKNKGWVANF
EKPKGNPSAFLKPATTVLSPYLKFGCLSSRYFYRQIQDIYKSMPKHTSPPVSLAGQLLWR
EFFYTAAFGTPNFDRMKGNRICKQIPWKDDDKLLEAWREARTGFPWIDAIMIQLRKWGWM
HHLARHSVACFLTRGDLFVHWEKGRDVFERLLIDSDWAINNGNWMWLSCSSFFYQYNRIY
SPTTFGKKYDPNGDYIRHFLPVLKDMPREYIYEPWTAPKSIQTKANCIIGKDYPMPVVSH
DSASKECRGKMGEAYALNKKLNGLVSEDDLKNLRRKLDESERQEPQAKRSKQQLLD
Download sequence
Identical sequences V7AU45
Phvulv091028929m|PACid:23546064 XP_007135727.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]