SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091029239m|PACid:23548397 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091029239m|PACid:23548397
Domain Number 1 Region: 222-421
Classification Level Classification E-value
Superfamily Tropomyosin 0.000017
Family Tropomyosin 0.00086
Further Details:      
 
Domain Number 2 Region: 421-646
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000785
Family Tropomyosin 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Phvulv091029239m|PACid:23548397
Sequence length 1824
Sequence
MATLSHANSRRMYSWWWDSHISPKNSKWLQENLTDMDAKVKQMIKLIEEDADSFARRAEM
YYKKRPELMKLVEEFYRAYRALAERYDHATGVIRHAHRTMTEAFPNQVPMMLTDDLPTVS
PLETEPQTPEMHHPSRAFLDPDEPQKEASAQFHVIKKNGGYSGEPDSSLNKTGLKQLNDL
YIPGEQENLTQFAERHARRGLNFLETLESIELNNGSNITRSHVSSESERVTKAETEILAL
KKAIAKLEDEKEAGLLQYQQCLEKLSSLQLEVSSAQENSQALDERASKAEAEVQALKETQ
IKLQAGSEDSLLQYRECLEKIAKLEECISFTQTEAGEHNERATRAENEAESLKQDLARVE
AEKEAIIVQYKQCSESLSKLEERLEEAKENARMAKEQANIAENEIGALKLEVTKLNEEKE
ETAFRYQQCLEIISGLEYKLSCAEEEVRRLNSKIDDGVEKLQSSEQKCLLLETSNHTLQS
ELQSLAQQMGSQSEELTEKQKELSRLWGCIQEERLRFIEAETAFQTLQQLHSQSQEELRS
LAAEFHSKVDILGYVESRKQALEDEIHRVSEENKILNEVKISSSLSITNLQDEILNLRET
IEKLEREVELRIDERNALQQEIYCLKEELNDLNKKHEAMMEEVRSTDLDPQCFGPSVKKL
QDENLKLKETCEADKGEKEALLVKLETMEKLLEKNTVLENSLSDLNAELDSVRGKVKVLE
ETCQSLLVEKSNLATEKASLSSQLQSTTEKLEKLSEKSNLLENSLFDVNAELEGLRMKSR
LLEDTCQSLDHEKSSIFEEKETLVSQMNITHQTLKDLEKLHSELESKHLELKGERESALQ
KVEELLVSLYSEREEHSRVLKLNEDELAEKELQIHILQEDANCKKTEYEEELDRAIHAQI
EIFILQQCIDDLEKKNFSNLVECQRLLEASKMSDRKISKLETENVQKQVDVNSLSEKIKI
LRIGLIQVLKTLENNSGHFCEDMLEEDQMLLNHTYEKLQESQKSFDTIFNEGQKMAIENS
ILVTFLEQLKLKVESLVIQRDALDEQFSIQSQQFLALQIEVQKILENNQELKSTISKGEE
RMEVMTTEISNLQKKLSDIEKNHNSLQEDSCKILEEKKSLMRSFMDLGEVKSKLEEEICF
MIHETITQSNISLIYENVIFEKLLELKELGEDLDNHCSANNDLEERLKVVVGKLENAEME
NSHLKESFVKSNVELHVVESLNDELSCQIRDEREMLNQKENELLEAAEMFHVLHSEKTEL
QRMVEDLKIKYDEARVMLEEQANKILKLSSDKDHQNEELIGLCEVNQKLESEMGYLRQEL
GQTKLREKKLGYEVLKGTNEIEQWETQASTLFAELQISAVNGALLEGKVSELADACKNLE
LRNYSKDIESERLKERVSKLEIENGRLSGQLAAYVPAASALNDSITTLEMQTLAHAKPDD
REETKVKILVSKGFTENGQQTHEDKTVKAPDALPAFQDMQRRINAIAMLVKQLNESFKLK
NETREIQELKSGITRHEENIQASKHVTQDQGKSDIQVTEIEVLPKDIMLDQISECSSYGI
SRRREILEADDQMLEMWETEDKDGPIGKQVEKTQRMASSEAAGNHQRGTTKEPKNKYPSK
DSLVEKELSVDKLEISRRLTQHREEGNQTKTLERLDSDAQKLTNLQITIQDLMKKVDVNE
KNTKGKGVEFDEAKGQLEASQETITKLFDANRKLMKNVEEGTLSSAGKSGGESDESGSVS
RRRVSDQAQRESEKIGQLHLEVQRLQFLLLKLGDGKESKEKTKTTDRSPRVLLRDYLYGG
TRSNNQKKKKLPFCSCVRPPTKGD
Download sequence
Identical sequences V7BI98
Phvulv091029239m|PACid:23548397 XP_007144654.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]