SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Phvulv091030475m|PACid:23558705 from Phaseolus vulgaris v186

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Phvulv091030475m|PACid:23558705
Domain Number 1 Region: 264-372
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.71e-16
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 60-187
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000416
Family BTB/POZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Phvulv091030475m|PACid:23558705
Sequence length 588
Sequence
MDNSNDSSSSLTFVSSQLSHGSSNHNVSSFTSNEHGANIEILTLNKLSGSLEKLLIDAEY
DYSDAEIVVEDISVGVHRCILASRSPFFHELFKKGTDGSGKEGKPRYLMSELVPYGAVGY
EAFQVFLYYLYTGRLKDSPTEVTTCVGETCIHDACRPAIDYALELMYASAAFLMKELVLL
FQRQLLNFVDKALVEDVIPILMAAFNCQLEQLLSRCIHKVASSDFDSISLEKELPHEVVT
EIKSCRLSFQPESAADAMEVEPLSEKSIMRIHKALDSDDVELLKLLLNESRVTLDDAYAL
HYACAYSDSKVIQELLGLGMADILRRNSRGYTVLHVAARRKDPSILVALLNKGACATDTT
PDGQTALSICQRLTRRKDYHEKTVKCKESNKDRLCVDVLEREMRRSSMTVSMSVSSQLTA
DDLHIRLDYLENRVTFARLLYPAEAKVAIENAEADSSSLHANASALEGANGNLKVDLNES
PSARTRKLQLRLHALMKTVENGRRFFPHCSEVLDKFLEDDMPDVFFLEKGSEEEQRMKKA
RFMELKDDVQKAFHKDMAENNHTAFSSSVSSSSSSTRRESLNHRVRKK
Download sequence
Identical sequences V7BAE1
Phvulv091030475m|PACid:23558705 XP_007141442.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]