SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294084532|ref|YP_003551290.1| from Candidatus Puniceispirillum marinum IMCC1322

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294084532|ref|YP_003551290.1|
Domain Number 1 Region: 541-959
Classification Level Classification E-value
Superfamily ALDH-like 3.53e-109
Family ALDH-like 0.00000108
Further Details:      
 
Domain Number 2 Region: 179-498
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.85e-93
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000133
Further Details:      
 
Domain Number 3 Region: 23-173
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 5.23e-31
Family N-terminal domain of bifunctional PutA protein 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294084532|ref|YP_003551290.1|
Sequence length 1093
Comment proline dehydrogenase [Candidatus Puniceispirillum marinum IMCC1322]
Sequence
MHGVHSVSDDVSWGAGVFPAVAPVPDEDALVSGFCRNPVLDNASRDTVLEQARQIVAVAR
DAGSLFSAEKIMAVYKLSTAEGRMIMEMAEALLRVPDAATRDFLIFDKLASGHWLDADAT
GFVRGLETALELASGIVRGQRDKGLKAMVSKLGVPAVRRAIETAMRQMGGQFVFAETIEA
AVTHLNDGDKLYSFDMLGEAARSADDCDRYFAAYAHAIACAGAKAKADDVNHNSGVSVKL
SALSCRLQTRYWSASCNALIDRVVQLALAARQHNIPLTIDAEEYSRLKPSLYVYERLLAH
PQLRGWSGIGIVVQAYARHAGAVIDWLEQQAQRHAVRIPVRLVKGAYWDTEIKIAQEKGL
ADFPVYTSKNHTDLAYLAHAKRLMTASQHFLPQFASHNAYTLAAVTHLAHSIKPASYELQ
KLHGMGDAVHNELSKITSAPLRVYAPVGCHQDLLAYLVRRILENGASSSFMNKLADVQVG
IEDLVTDPYTKIDNAKALLATGVQMFAPWRQNSRGFDEEDVESVRGFAKAIASPDMPSRP
DQASREDVAIAFDQADNASWQHLSAPQRADIVDHIADHYEQAADRLYHLLVHEAGKTIDD
AVGEVREAVDFCRYYAVQTRQLGANSRARGTVVAISPWNFPLAIFTGQVVAALAAGNAVL
AKPAAQTPRIAALAISLMYKAGVPDDALHLLCGGGAVGDMLTKAGQADMVVFTGSTATAK
IIEGAIAQSGKPHAPLIAETGGLNAMIVDASALLERAVDDILTSAFRSAGQRCSALRILY
IQDDIAADLISMISAAAAMLKVGDAADMDTDIGPIIDQDAKTRIDQHVAAARHDGRLVWQ
GTAPTLGCFCAPSIIKLAGIESLESEIFGPVLHVATYKAGDEANVVEAINKSGYGLTFAM
HSRIDANIKAVSDMINVGNVYINRNQIGAVVGAQPFGGHGLSGTGPKAGGGAYLRAFMTM
PETSHSGDAMLSPVLLPGPSGERNSYSIMPRHGTVLVCHPDAQTRGRLSQIARDHGNSVQ
EVTAIPDHDNFDVVITHVDHHVDLAALRKALHRSSQRVIPFITDQGGHVWLQQEKHICRD
MTASGGNIDLLMR
Download sequence
Identical sequences D5BSF9
gi|294084532|ref|YP_003551290.1| WP_013045835.1.22483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]