SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294084651|ref|YP_003551409.1| from Candidatus Puniceispirillum marinum IMCC1322

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294084651|ref|YP_003551409.1|
Domain Number 1 Region: 2-281
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.3e-84
Family Methylenetetrahydrofolate reductase 0.000000906
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294084651|ref|YP_003551409.1|
Sequence length 306
Comment 5,10-methylenetetrahydrofolate reductase [Candidatus Puniceispirillum marinum IMCC1322]
Sequence
MVDNKKPKISFEFFPPKSLSASFAIWETLHMLLPLHPEFVSVTYGANGSTRDLTRDMTKT
IAQTWHVDVAAHLTCVDATRHAVMNVAKGYLDVGVKQIVALRGDAPGGASRFTPTPDGFA
DAVELVAALAKRNFDKIWVGAYPEPHPDAAYDGADIDWLKRKIDAGATGAITQFFFDSDM
FLRFRDRAVKAGIDTPIVPGILPIENWEKTKLFAARCGASIPDSLAHEFDMAKRNNVEDI
LSVVVATDICVDLMDEGVDQFHFYTLNKPFITRDVCLALGIQPLKDNLIHANFRSDNITS
DARKSA
Download sequence
Identical sequences D5BSS8
WP_013045954.1.22483 gi|294084651|ref|YP_003551409.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]