SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295135461|ref|YP_003586137.1| from Zunongwangia profunda SM-A87

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295135461|ref|YP_003586137.1|
Domain Number 1 Region: 123-274
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.15e-44
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00024
Further Details:      
 
Domain Number 2 Region: 398-558
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.76e-32
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00094
Further Details:      
 
Domain Number 3 Region: 21-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.18e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0083
Further Details:      
 
Domain Number 4 Region: 254-278,307-408
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.45e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|295135461|ref|YP_003586137.1|
Sequence length 697
Comment ferredoxin-nitrite reductase [Zunongwangia profunda SM-A87]
Sequence
MQSFRTEIENPVVEKDIIDLEKKIRLFREGKADEEKFRSLRLARGVYGQRQAGVQMVRIK
LPFGKVTSEQLHRIADVSDEYSTGRLHITTRQDIQIHYVSLDRTPELWAQLEKDDITLRE
ACGNTVRNITASPTAGIDVDEPFDVSPYADAAFRFFLRNPICQEMGRKFKIAFSATDEDT
ALSYIHDLGFIPKLKNGKRGFKVMLGGGLGSQPRHADKLYDFIEAEKIIPLIESVLRVFD
RHGERAKRLKARMKFLIKDIGLEAFLELVDEQKKALSQEKVEFHIDKFEAAPPLQDIEVP
SIKIEDEKDYKVWRNTNVIPQKQEGLFAIGIRVPLGDFYTGGARQLAGLIKKYAGNEIRL
SLRQDILVRHVREELLPFFYTELKKLGYAETGYDKTVDITACPGTDTCNLGIASSTGIAD
VLEDVLKEEYPQFINGKDITIKISGCMNACGQHNMAEIGFQGMSIKSGKAVAPALQVLLG
GGVLGNGEGRFADKVVKVPSKRGPEALRVLLNDFDANARSDEKFIQYYDRQGKTYFYDLL
KDLADTSDLSENDFIDWGHEKPYIKAVGVGECAGVVIDLIATLLFESEEKIDNAQSALDR
KAWADSIYHSYTSIVNSAKALLLADDVKTNTQAGIIAQFDELFVETGKIELSTSFKEFTY
QLNEHEPSEEFAQKYIEDARLFLKRVDAYRTKEVQDV
Download sequence
Identical sequences A0A2E0NY95 D5BKM9
gi|295135461|ref|YP_003586137.1| WP_013073025.1.2279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]