SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295131985|ref|YP_003582661.1| from Zunongwangia profunda SM-A87

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295131985|ref|YP_003582661.1|
Domain Number 1 Region: 171-315
Classification Level Classification E-value
Superfamily CBS-domain pair 3.54e-22
Family CBS-domain pair 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|295131985|ref|YP_003582661.1|
Sequence length 363
Comment hypothetical protein ZPR_0102 [Zunongwangia profunda SM-A87]
Sequence
MCSILEAALLSFTPSYIKIKKQEGKHYAEVLANFKKDIDKPLIAILTINTVAHTVGSILV
GVQAEKTYGDGSNAVGIVSGILTLGILILSEIIPKTLGATYWDKMGAFTANTLRLMIAPL
KYTGLLWLLMLTTRLIGKSAKVNTMSREEFAAITEAAEEEGVFEENESTVIKNMLVFKSV
VAKDIMTPFSVAITEDESMSIADFHHSHKNLKFSRIPVYKDKSNNISGFILKDDVLEEMI
KQNGQSKLETLKREIFVTTSEVPIPDLFDIFIRKRTHISIVTDEFGNVVGLVTMEDIIET
LLGLEIMDESDSIEDMQKLARKSWERRAKRLGLIQRREEAQPEELQNEDNVSEDSSGDRQ
NKG
Download sequence
Identical sequences D5BBN1
gi|295131985|ref|YP_003582661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]