SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295133569|ref|YP_003584245.1| from Zunongwangia profunda SM-A87

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295133569|ref|YP_003584245.1|
Domain Number 1 Region: 3-193
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.22e-29
Family Pyruvate oxidase and decarboxylase Pyr module 0.0083
Further Details:      
 
Domain Number 2 Region: 381-575
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.03e-24
Family Pyruvate oxidase and decarboxylase PP module 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|295133569|ref|YP_003584245.1|
Sequence length 576
Comment menaquinone biosynthesis protein MenD [Zunongwangia profunda SM-A87]
Sequence
MKYSKIPLARNVVSLCVSKNIKHVVISPGSRNAPLTIGFTYHPDIKSYSIVDERCAAFVA
LGMAQQLQQPVALVCSSGSALLNYYPAISEAFYSDIPLVVISADRPIERIDIGDGQTIRQ
KNVYENHILYSANLYSELVLESQIIDKKLLQKQWEAQKHNEREINLALNKAIEEKGPVHI
NVPFYEPLYDTVENIEVNPIEIFPEITKRHYSKEELLAYAEIWNKAKRKMVIVGVAQPNA
VEQKFLEKLAKDDSVIVFTETTSNLHHEEFFTRIDTMIGPIEKDENMQELFEALRPDILL
TFGGMIVSKKIKAFLRNYNPKHHWHIDSKKAYNTFFCLNKHFETSVNDFFLEFFPLTTKI
DSDYGEFWKNIRQKRQIRHDAYMDEIPYSDLKAMQLLVSKVPDNYIMQLANSSTIRYAQL
FKWPPSLRIFCNRGTSGIDGSISTAAGSAMASNEPVLMVTGDLSFFYDSNALWNKYLPSN
FRIIILNNSGGGIFRILPGNKNSENFESFFETVHDLKAEQLAKMYNFGYKAASSETEISE
SLNTFFDASGRPKILEIFTPRKVNDKVLLEYFSYMK
Download sequence
Identical sequences D5BLT3
WP_013071192.1.2279 gi|295133569|ref|YP_003584245.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]