SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|295134124|ref|YP_003584800.1| from Zunongwangia profunda SM-A87

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295134124|ref|YP_003584800.1|
Domain Number 1 Region: 21-205
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.01e-52
Family Methylesterase CheB, C-terminal domain 0.00028
Further Details:      
 
Domain Number 2 Region: 286-480
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.46e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00082
Further Details:      
 
Domain Number 3 Region: 1072-1215
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.85e-36
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 4 Region: 215-288
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000000497
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0051
Further Details:      
 
Domain Number 5 Region: 848-976
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000733
Family N-terminal PAS domain of Pas kinase 0.056
Further Details:      
 
Domain Number 6 Region: 984-1066
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000000314
Family Homodimeric domain of signal transducing histidine kinase 0.0039
Further Details:      
 
Domain Number 7 Region: 728-848
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000471
Family Heme-binding PAS domain 0.034
Further Details:      
 
Weak hits

Sequence:  gi|295134124|ref|YP_003584800.1|
Domain Number - Region: 656-742
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0241
Family FCH domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|295134124|ref|YP_003584800.1|
Sequence length 1218
Comment two-component system sensor histidine kinase/methyl-esterase/transferase hybrid [Zunongwangia profunda SM-A87]
Sequence
MTRNNKLTPKEKTRKHENAQSRIIAVGASAGGLEALKAFFTGIPEEDNNTYVVIQHLSPD
YKSMMGELLAKSTKFPIKQIKEGMQMEEKTIYLIPPKCNLLVEDGCLKLVEKPERAHLNL
PIDMFLESLSSYKKEKAIAVILSGTGSDGTRGIRAIKDRDGMVMVQDPEQAKFDGMPKSA
IQTGLVDYILPVEEMGEELRKFINAPMVFDIENHDVEFDQKTLSKILHLIDEKTGLDFRE
YKYSTLARRLARRVNVGGCSSLEEYYDMLVHNDDEIPMLYREFLIGVTNFFRDQRVWEII
ADDIIPELIESKKDNDILKIWDVACSTGEEAYSLAMLLHEEMQRQDKMLEIKIFATDISQ
EHLDIGSAGIYSESVVANVEDKFLKKFFIKKPEGYQIVEKIRRMVIFSKHNIIKNPPFSN
MDMVLCRNLLIYFQSTIQKKTMDVLHYALKEYGFLVLGTSETITSHRDSFEDISRKWKIF
RNVHPRARIRTKNLRPTAGRINDHDEKHHKPRNSDNRTYNSSKQKFVNELNEAIMEQFGA
ASVYVDSEFNIMEAVGEFRKYANLPVSGFTTNLIEMLNKDLKHVVQSTTKKSAKEKKRVV
YHDAIVKEANGVVMKLDIVVKPFKPKNLDNESNFVLTFIEKEVKEEDTIEVEQITISGRT
QEYIVELEEELKKTKEELQTSLEEIETSNEELQAANEELLASNEELQSTNEELQSVNEEI
NTVNAENIQKMDDLAQLNADMNNLLESTNIGTIFLDSDLRIRKFTPAIKKHFSLINSDIG
RPIDNFTTNFGVNRGKGLVDRCNKVMETGKILERNILSKEGRNYLQRISPFRNGEDNTEG
IVITFVDIESLQKAKNKLLASERRFKSFYEEDPVLHFSVDPKTSEIVQCNQEAVEKLEYD
SKEDIIGKPIFELYEDESKLKALRLNKLFQEKGELKNVEQEMVTKNGKIVPVIMNSTVEL
DENGNGITNRFTCVDISELKQVQEELESQKKDLERANHDLEQFVSICSHDLQEPLSTIKF
GSDILGKIYSDKLDQKGKDYIQYIDEASDRLSAQIKALLEHSRIGRNTKKKMVDTRELVE
VVRYDLTKRIKDTNAKVHIGSLPKLMVYEVEMRLLFQNLLSNALKYCAKDKTPEVRISAY
QEDEYWVFSVMDNGIGISEEDQKNIFTIFNRVPTEEKYEGTGVGLAHVHKIVILHGGSIW
VDSQPGVGSTFYFKIKAK
Download sequence
Identical sequences D5BC05
gi|295134124|ref|YP_003584800.1| WP_013071705.1.2279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]