SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|295135488|ref|YP_003586164.1| from Zunongwangia profunda SM-A87

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|295135488|ref|YP_003586164.1|
Domain Number 1 Region: 1-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.12e-69
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000134
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.75e-42
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|295135488|ref|YP_003586164.1|
Sequence length 325
Comment pyruvate dehydrogenase E1 component subunit beta [Zunongwangia profunda SM-A87]
Sequence
MKTIQFREAVQQAMSEEMRKDESIYLMGEEVAEYNGAYKASKGMLDEFGPERVIDTPISE
LGFSGIGIGSAMNGNRPIIEFMTFNFSLVGIDQIINNAAKIRQMSGGQFNCPIVFRGPTA
SAGQLGATHSQAFESWYANCPGLKVIVPSNPYDAKGLLKAAIRDDDPVIFMESEQMYGDK
GEVPEEEYVIEIGKADIKREGTDVTIVSFGKIIKEAYKAADELEKEGISAEVIDLRTIRP
MDHATIIESVKKTNRLVILEEAWPFGNISTEITYQVQEQAFDFLDAPIIKINTADTPAPY
SPVLLKEWLPNSEDVVKAVKKVMYK
Download sequence
Identical sequences A0A2E0NXT1 D5BKQ6
gi|295135488|ref|YP_003586164.1| WP_013073052.1.2279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]