SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|408676128|ref|YP_006875955.1| from Streptomyces venezuelae ATCC 10712

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|408676128|ref|YP_006875955.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.44e-112
Family FMN-linked oxidoreductases 0.00000000115
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.35e-42
Family N-terminal domain of adrenodoxin reductase-like 0.00000998
Further Details:      
 
Domain Number 3 Region: 461-519,555-649
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.4e-22
Family C-terminal domain of adrenodoxin reductase-like 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|408676128|ref|YP_006875955.1|
Sequence length 671
Comment 2,4-dienoyl-CoA reductase [Streptomyces venezuelae ATCC 10712]
Sequence
MTPYPHLLSPLDLGFTTLPNRVIMGSMHVGLEETEHGFERMAAFYAERARGGVGLIVTGG
IAPNAAGRPWDGGAKLTTAEEVAEHRLITDAVHAEGGRIAMQILHFGRYAYHPGLVAPSA
LKAPISPFVPNELTDAEVEQTVEDYARCAELAKEAGYDGVEVMGSEGYLINEFIAAATNQ
RTDRWGGTYENRVRFPLEIVRRIRERVGEDFILVYRLSMLDLVPGGSTLEEVVQLAKEIE
AAGATIINTGIGWHEARIPTIATSVPRGAYTWVTKKLMGAVSVPLVTSNRINTPDVAEEI
LADGRADLVSLARPFLADPDFVAKATADRADTINTCIGCNQACLDHTFNLKITSCLVNPR
ACHETELVLSPTRRAKRIAVVGAGPAGLSCAVSAAERGHSVTLFDAASEIGGQLNIAKRV
PGKEEFDETLRYFRVQLAERGVEVRLDTPVSAGDLDDFDEVVVATGVSPRTPAIPGADHP
SVVSYLDVLRDGAPVGERVAIIGAGGIGFDVAEFLTDGGEGASQDPETYFRQWGVDTAYE
NRGGLRTPERTAPPRQVHLLQRKETKVGAGLGKTTGWIHRTELKHRGVAMVAGVSYDRID
DEGLHVTIGGEQQLLPVDTVVLCAGQEPRRDLYEELVAAGRVAHLIGGADVAAELDAKRA
IDQGTRLAATL
Download sequence
Identical sequences F2R704
WP_015031615.1.22668 WP_015031615.1.41968 gi|408676128|ref|YP_006875955.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]