SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|291615751|ref|YP_003518493.1| from Pantoea ananatis LMG 20103

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291615751|ref|YP_003518493.1|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 5.49e-129
Family UbiD middle domain-like 0.0000000000263
Further Details:      
 
Domain Number 2 Region: 323-487
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.14e-64
Family UbiD C-terminal domain-like 0.0000000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|291615751|ref|YP_003518493.1|
Sequence length 494
Comment UbiD [Pantoea ananatis LMG 20103]
Sequence
MKYQDLRDFIALLEQRGELKRISHEIDPELEMTEIADRTLRAGGPALLFENPKGYDMPVL
CNLFGTPKRVAMGMGQEEVSALREVGELLAFLKEPEPPKGFRDLFSKMPQFKQVLNMPTK
RLRNAPCQEEVFSGDEVDLTRIPVMKCWPGDAAPLITWGLTVTRGPHKERQNLGIYRQQV
IGKNRLIMRWLSHRGGALDYLEWTKAHPGERFPVSVALGADPATILGAVTPVPDTLSEYA
FAGLLRGNKTEVVKCISNDLEVPASAEIVLEGYIEPGDMAPEGPYGDHTGYYNEVDSFPV
FTVTHITQRHQPIYHSTYTGRPPDEPAVLGVALNEVLVPILIKQFPEIVDFYLPPEGCSY
RLAVVTIKKQYAGHAKRVMFGVWSFLRQFMYTKFVIVCDDDVNARDWNDVIWAITTRMDP
ARDTVLVENTPIDYLDFASPVSGLGSKMGLDATNKWPGETQREWGTPIVKDPAVTARIDA
IWDDLGIFKQPSQR
Download sequence
Identical sequences A0A0H3L695 A0A221NBI4 D4GGR4
gi|291615751|ref|YP_003518493.1| gi|386017933|ref|YP_005936234.1| gi|378769184|ref|YP_005197659.1| gi|386081260|ref|YP_005994785.1| WP_013024103.1.100875 WP_013024103.1.101504 WP_013024103.1.22816 WP_013024103.1.25584 WP_013024103.1.31804 WP_013024103.1.32245 WP_013024103.1.34141 WP_013024103.1.37529 WP_013024103.1.41207 WP_013024103.1.44942 WP_013024103.1.45452 WP_013024103.1.46475 WP_013024103.1.47668 WP_013024103.1.55774 WP_013024103.1.57057 WP_013024103.1.61179 WP_013024103.1.64732 WP_013024103.1.7182 WP_013024103.1.89124 WP_013024103.1.95616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]