SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|291617902|ref|YP_003520644.1| from Pantoea ananatis LMG 20103

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|291617902|ref|YP_003520644.1|
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 3.61e-27
Family PA0094-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|291617902|ref|YP_003520644.1|
Sequence length 146
Comment hypothetical Protein PANA_2349 [Pantoea ananatis LMG 20103]
Sequence
MNYQFNEGAFALFPAAWQDTTMNILRDDASGLALVVSRGVIPEDSDAEKEFQRQWDTLRS
QMGHIQQTEFVRVTAGADNALRALEVETAFDRNGQAVWQRQLATQVPDSNILMIFTLSAM
RAFNEEDGQRWSAFKQSLSLNNPRKA
Download sequence
Identical sequences D4GHJ9
gi|291617902|ref|YP_003520644.1| WP_013026228.1.25584 WP_013026228.1.45452 WP_013026228.1.46475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]