SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289449470|ref|YP_003475022.1| from Clostridiales genomosp. BVAB3 str. UPII9-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289449470|ref|YP_003475022.1|
Domain Number 1 Region: 11-92,245-460
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.85e-87
Family Bacterial dinuclear zinc exopeptidases 0.0012
Further Details:      
 
Domain Number 2 Region: 93-245
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 4.85e-30
Family Aminopeptidase/glucanase lid domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|289449470|ref|YP_003475022.1|
Sequence length 465
Comment aminopeptidase I zinc metalloprotease (M18) [Clostridiales genomosp. BVAB3 str. UPII9-5]
Sequence
MLNLTEEAKLSLDELMKVLAASHSAFHSTAALVKMLKAAGFNDYTATGITKMEPGMRGFI
TQNKSALMAFRIGEKPLENGFKIVGAHTDSPTLRIKPNPIIEREGCLLLNTEVYGGPILN
TWFDRPLSLAGRIVYRKDGKLRDELIDLVDPLLILPNLAIHMNRKVNEGEPIIRQKMLLP
VIALADSVEDFGRTVNNFGNVAGTDADVPASKQQNKLNKLKLIETICAAKLGCPSEDIID
YDLYVYDIQPPCVVGLNHELLSSPRLDNVAMSFAAVSSLIKSTSATATCVAFASDNEEVG
SRSRQGAASMFCRDMLESLFLASGGDRLGFLNCLNNSFLISADQAHAVHPHYPEVADPVN
HPRINHGPVIKLAANLSYATDAGSAAVFKELCRQAEAPFQYFVNHSDRPGGSTIGPISTA
YLHCPTVDIGNAIWGMHSVRETGGVADTYILIKILRNFYSNNGII
Download sequence
Identical sequences D3R1G5
WP_012993592.1.20852 WP_012993592.1.57782 gi|289449470|ref|YP_003475022.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]