SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289449494|ref|YP_003475218.1| from Clostridiales genomosp. BVAB3 str. UPII9-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289449494|ref|YP_003475218.1|
Domain Number 1 Region: 60-145
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.22e-21
Family Ribosomal protein L9 C-domain 0.00059
Further Details:      
 
Domain Number 2 Region: 1-53
Classification Level Classification E-value
Superfamily L9 N-domain-like 1.92e-16
Family Ribosomal protein L9 N-domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|289449494|ref|YP_003475218.1|
Sequence length 147
Comment 50S ribosomal protein L9 [Clostridiales genomosp. BVAB3 str. UPII9-5]
Sequence
MKVILLSDVKNLGKADAIVEVSDGYARNCLFKQKLAIEATSANINSYKIKKQAKLAAEKR
ELAAAEEDGKKLAGKTFKLAMKAGEGGKLYGALTAQEVATLLQKSGYEIDKKNITINSVL
KNVGRTTATVKLHSQVKVDINIEVEAL
Download sequence
Identical sequences A0A2J8B4K9 D3R211
WP_012993397.1.20852 WP_012993397.1.57782 gi|289449494|ref|YP_003475218.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]