SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289450034|ref|YP_003475216.1| from Clostridiales genomosp. BVAB3 str. UPII9-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289450034|ref|YP_003475216.1|
Domain Number 1 Region: 30-256
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.84e-46
Family PP-loop ATPase 0.00024
Further Details:      
 
Domain Number 2 Region: 397-461
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000000706
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.01
Further Details:      
 
Domain Number 3 Region: 240-335
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000157
Family MesJ substrate recognition domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289450034|ref|YP_003475216.1|
Sequence length 483
Comment tRNA(Ile)-lysidine synthetase [Clostridiales genomosp. BVAB3 str. UPII9-5]
Sequence
MNSMNKNLVLSPLAYSLYKRGLAENWWALMDNLVVACSGGADSLALLYVLHEISTVVKFK
LEVIHFNHGLRLEAAEEAAAVETIARSLQLPFTLGVWDRGNCATPSNSVGSNDFFDGISE
NASRQARYAFFKHYLAENCASERSYIALAHHLDDQAETVFFRLMRGCGINGLQGMRNFSG
RYFRPFLQTPQAKLKSYLISHNIAWSEDASNSDEKFTRNYLRHSLLPLLSDKFGKNTKVH
LANIAAAAAEAEDFLEDSAQSYLPNYGEPLDCHLLKDKAPALIKTVIRLFYVKNHPTGLD
INYAQLTKLADFILQGENNRRIDLAGSCYMVIHNGMAYLKKSMTELADPHIINAPATVNE
AASAENLFWPTDKIANNSNSIHNLMIKSVEKNCHIIYNDRIWIIHDCSPQELELRNRRPG
DWQRCGNGHKRSLKKIFNECKIPPDKRSVLCLLARGNEIVWPNFTKECKNGKSCYGKNFH
HKS
Download sequence
Identical sequences D3R209
gi|289450034|ref|YP_003475216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]