SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289450196|ref|YP_003475769.1| from Clostridiales genomosp. BVAB3 str. UPII9-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289450196|ref|YP_003475769.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.7e-31
Family Ribosomal protein L6 0.0000589
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 9.42e-23
Family Ribosomal protein L6 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|289450196|ref|YP_003475769.1|
Sequence length 181
Comment 50S ribosomal protein L6 [Clostridiales genomosp. BVAB3 str. UPII9-5]
Sequence
MSRIGRKPIDVPANITVKVNDGVVEVTNGKETLTQKIPRDITVKVEGKQVIVERPSDDKE
HRALHGLTRSLINNMVIGLTTGFQKKLEINGIGFKAGKSGKKLVLNIGYSHAVEMEEPAG
ITIEVPQPNSIVVKGSDKQLVGEVAAKIRAKRLPDAYKGKGIKYDFETLHLKEGKTGAKG
K
Download sequence
Identical sequences A0A2J8B0K9 D3QZ86
gi|289450196|ref|YP_003475769.1| WP_012992844.1.20852 WP_012992844.1.57782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]