SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|289450384|ref|YP_003475647.1| from Clostridiales genomosp. BVAB3 str. UPII9-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|289450384|ref|YP_003475647.1|
Domain Number 1 Region: 128-357,497-608
Classification Level Classification E-value
Superfamily Subtilisin-like 2.88e-57
Family Subtilases 0.00072
Further Details:      
 
Domain Number 2 Region: 366-444,480-548
Classification Level Classification E-value
Superfamily PA domain 5.49e-20
Family PA domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|289450384|ref|YP_003475647.1|
Sequence length 1777
Comment hypothetical protein HMPREF0868_1390 [Clostridiales genomosp. BVAB3 str. UPII9-5]
Sequence
MKKTLTALGLVTALLLTSLPGGLLAAAETGEAARANAAVTESTKGEETVRVIIQTETAEQ
AEELKHEVGLKPGAKICREFGLSFNGFSADIKESEYLRLQFDKRVKRITKSRLFYPTMHT
AKAIGQIDAAISKYKNKGEGMVISIIDSGLDVTHKDFQKLDNPAAAKIKDVLPLGGENKD
TKFNLKVPYGYNFADHSYRVKGFASNHGIHVSGIASANASDEDVQAHRGIDGVASQAQIL
AMTVFSNNSEFKGAQEDDIIAAIERSIEKKADVINMSLGSPGGFMDDADPTAKAIKKATE
HGIVVVVAAGNETAAFADKFGKEIRNVGGRQDIGIVGSPSTARAAFSVASMENTHEYISK
FSFAAADGQEVTYPYSLDNGVNPDRELPIVLAGLGKTEDYNNVDCHGKLALVKRGQITFT
DKAKNAKAAGAAGVIIYNSDNNKIGYAIDGMGDFPVFNILNDAGEKLREALAKNPALKIH
FKKELVQSPNENSGCMSSFSSFGTTNDLSFKPEITGIGGKVYSTDNNGKYVMMNGTSMAS
PYVAGATALVMSQAKKENLPVKDYVAWTKTTLMNTAKTVMNKSLPTPLPYSVRRQGAGLI
QVQNAMDNRVALTYETADGSAAATLRSFNGSKTFKAVLRNLGKESLTFTVEPGKVYTTET
VNDNLLEKEAAAQITADRSSVTVPAGGTAEVKLTINATKLNNSFVEGFVRFVSQKNGQPD
LHLPYLGFAGDFNKESIFDNLDTADNQNGTFYGETRLMTLNRNKLNPFSLGKIVPLGLKP
GADARKAKPLSEHWAISPNNDGLADAVIPEIAVLRNAARIEFNILNSKHEPLRRLGISND
VRRQSLKSYIDRKTKNELFPAFPYVEGIWDGRLYNPKNGKMEIAPDGQYYLAAKAYLTSA
SEPQELVFPLKVDTKTPQVTLLKTADQKEYELTPKGRLLKFKVEDAGGVAAVKAEAGKKE
LEVKQNGDHYEALLPYGIELSEDVMITADDYAYNKAIKMVEKIKGNSLSFINWQPLVTKK
INPIMGNPYSGQTKNKDTKKIALKFVGETNGKQIISKDCPVDNGKFPFASYVLKPDEQGK
YQAYALEKDANGLTIKETSLGKFVYDYTKPTVTFNYVRKNEVSCPDNAQKNKKCIGYVMR
KNKDGTATYTGQVHDNVFSPKELTLSIGMRDNVVKIKDDGSFTYVLKTPSKLFDFINVSQ
PGDLNGNGSGGSSSISWLNLILPKKAKGLENTYLVSAYLDADQPDPAIPSAPTGGSSVAP
QPAAPTTVTNLPPFKMQVDSRVVINRKDLTSKVRKDGQDYFYTIECTTSRGDYKVFIDGQ
ETKPVFSNSSQSRFRREVKLKSGNNEFNIRCENSAGEVMKDLKVRIIFDTDLPNLVLRSP
LTAASKSGDNSNAAPGTTPIPGNPGGTSGSTTPAPAHGTHGNGAQAAGPKFEIIETWQDQ
VTFAGTVSDNGKGYRLYINGDSVASHESNGYLGDNAQEFKKVIPVKDNDIITLELNDIAE
NSMVVKYKIKKVAPPDIIKVEETAQATPAGFARITLKTTPEVSFDVKLGTVKLADLPLPK
APENTEFVGWYLDSRYTKPAGKEISAAMVLYPKFKSTVPPEQENESDEDDNYDNGDSDTS
DDNVIDSVSRLLPRRDENPTLPEPQPVVEKQTVKRVSDAPAATKAKTSKAMSNGKKADAT
NATSPTKPEATTTAEPSKSTEAATSSSKQASEAKDERTLAKMSTEIDSDANEKRLTGSSS
RTGYVIAGAVGAAVALGLIAGAVIHLLNGKRRRSKRY
Download sequence
Identical sequences D3QYW4
gi|289450384|ref|YP_003475647.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]