SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187734854|ref|YP_001876966.1| from Akkermansia muciniphila ATCC BAA-835

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187734854|ref|YP_001876966.1|
Domain Number 1 Region: 251-550
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 6.93e-84
Family DNA repair protein MutS, domain III 0.000000814
Further Details:      
 
Domain Number 2 Region: 552-784
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.72e-66
Family ABC transporter ATPase domain-like 0.000000532
Further Details:      
 
Domain Number 3 Region: 100-250
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 7.98e-37
Family DNA repair protein MutS, domain II 0.00043
Further Details:      
 
Domain Number 4 Region: 1-101
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 2.62e-29
Family DNA repair protein MutS, domain I 0.0000836
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187734854|ref|YP_001876966.1|
Sequence length 823
Comment DNA mismatch repair protein MutS [Akkermansia muciniphila ATCC BAA-835]
Sequence
MMDQYLRMKKGLPEDVLLFFRLGDFYEMFFEDAKEASAILGLTLTKRHGIPMCGVPHHSA
EGYIGRLVKGGKRVAIAEQTTIPQPGKLVERELTRVISAGTLADMNLLDSSRHNYIVALY
KDKKRFGLACVDHTTGEFSVAQFEHMDLLLDELSRINPSELLVSDEQTDCFPGTHPTLYY
DGYTFLPSTAIPNLLNHFRVHSLDGFGCGEMTAALGASGAVLHYLGYQLRRPTDHLRRIS
VRATENAVLIDQASQRNLDLVDSRGGVKLSLLGTLDRTSTPMGARKLRDWLLHPLCDLEK
LLARQEVIAVLLQEPYLMSKLRESLKNVRDMERLTGRISQGAGNARDLQALASSLARIPA
LRDDLESLPGGGDMLESIRSRMGCFDELVDLLQRALVDEPPVTIKEGGIIREGYHAGLDE
LRLASRDGKEWLARLQEKERKRTGIDSLKIRFNNVFGYYIEVTKSHYDKVPPDYQRKQTL
VNAERFITPELKQMENTILGADERSRQVEYEQFLLLREEVGRHIDDIQITADAMADLDVL
LGLAEGAQQYRYCRPVLDNSMTLRIVNGRHPVIEQNVSGDVFVPNDAFLEPEENRLILLT
GPNMAGKSTYIRQVALITLMAQIGAYVPAESAHIGLVDRIFCRVGASDDLARGQSTFMVE
MSETSLILNNATERSLIILDEIGRGTATFDGLSIAWAVAEYLHDELKSRTLFATHYHELT
DLANSRQGVQNYNVAVREWKEEIVFLRKIVPGAADKSYGIQVARLAGMPAVIVDRAKAIL
SHLEMNSTRPRRKERSRLAEPRAKNTDMEDDMPAGEYAQLELF
Download sequence
Identical sequences A0A1Y3SX00 B2UMX9
gi|187734854|ref|YP_001876966.1| 349741.Amuc_0346 WP_012419400.1.11081 WP_012419400.1.13503 WP_012419400.1.26090 WP_012419400.1.31314 WP_012419400.1.44559 WP_012419400.1.48500 WP_012419400.1.52179 WP_012419400.1.55880 WP_012419400.1.65144 WP_012419400.1.67314 WP_012419400.1.75205 WP_012419400.1.86927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]