SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187735429|ref|YP_001877541.1| from Akkermansia muciniphila ATCC BAA-835

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187735429|ref|YP_001877541.1|
Domain Number 1 Region: 83-176
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.57e-34
Family Ribosomal protein L6 0.0000418
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.16e-25
Family Ribosomal protein L6 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187735429|ref|YP_001877541.1|
Sequence length 179
Comment 50S ribosomal protein L6 [Akkermansia muciniphila ATCC BAA-835]
Sequence
MSRVGKKSITLPDKVTVKVNGSSVQVEGPKGKLSWTLPEGITATVEGNQLSVDRAGESRQ
LRALHGTNRSLLNNMVIGVSEGFVKNLEIVGVGFRAAVKGNILDLNLGKSHPINQVIPEG
LKVTVTENTKVTVEGIDKQVVGQFAAEVRAYYPPEPYKGKGVRFVGEVIRRKEGKSVGK
Download sequence
Identical sequences A0A1Y3SW90 B2UQM5
gi|187735429|ref|YP_001877541.1| WP_012419975.1.11081 WP_012419975.1.13503 WP_012419975.1.26090 WP_012419975.1.31314 WP_012419975.1.36645 WP_012419975.1.37524 WP_012419975.1.39922 WP_012419975.1.44559 WP_012419975.1.48500 WP_012419975.1.52179 WP_012419975.1.55880 WP_012419975.1.59221 WP_012419975.1.65144 WP_012419975.1.67314 WP_012419975.1.75205 WP_012419975.1.86927 WP_012419975.1.87234 349741.Amuc_0928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]