SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187734826|ref|YP_001876938.1| from Akkermansia muciniphila ATCC BAA-835

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187734826|ref|YP_001876938.1|
Domain Number 1 Region: 12-200,246-382
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.89e-64
Family TK-like PP module 0.026
Further Details:      
 
Domain Number 2 Region: 319-507
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.01e-52
Family TK-like Pyr module 0.0098
Further Details:      
 
Domain Number 3 Region: 493-626
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.81e-30
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|187734826|ref|YP_001876938.1|
Sequence length 628
Comment deoxyxylulose-5-phosphate synthase [Akkermansia muciniphila ATCC BAA-835]
Sequence
MNSPSPELPELLASIRSHADLMEIPESELPRLAEEIRNTLIHSLSLTGGHLGPNLGVVEL
SIALHRVFETPRDKIIFDVSHQAYVHKMLTGRAPLIHTIRQHGGLSGFAKMSESPHDSYG
AGHAGTALSAALGMCAARDLKGEDYHVVAVAGDAAFTCGTTLEALNNISQTTKRYITILN
DNEWAIDKNVGALAKYFNSLQTSETFSWLRDKTASFIEKLGGTQARDFAFKLEGTTKNLI
FPSLLFNKFGLRYFGPLDGHDIPTLIRTLAYIKDLNEPVILHVVTQKGKGYQPALDNPTK
FHGLGSYCVRDGETQAAPTPTFSHIFGSTLVEMAREDESITAITAAMASGTKLDLFKEAF
PKRYFDVGIAEEHGALFACGLAAEGMKPYIAIYSTFMQRCIDMIQHDAALQKLPVRFCMD
RAGLSPDDGPTHHGLFDIAMIRSIPNIVFMQPKDEAEFVHMLRTMNHYQNGPTVIRYPRG
CGAGTPVPAKAEILPIGKAEVLQAGQDVTLVSLGTMIGIARETASLLEVRGYTVTLINAR
FIKPLDDECIRRHAARSRVVCTFEDHSISGGFNSAVLESLETGDVKTPVEAIAWPDQFIE
HGSESILRKKYGLTAEAALQKIIPHLNS
Download sequence
Identical sequences A0A1Y3SVG6 B2UMV1
WP_012419372.1.11081 WP_012419372.1.31314 WP_012419372.1.48500 WP_012419372.1.52179 WP_012419372.1.55880 WP_012419372.1.67314 WP_012419372.1.75205 WP_012419372.1.86927 349741.Amuc_0315 gi|187734826|ref|YP_001876938.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]