SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187735388|ref|YP_001877500.1| from Akkermansia muciniphila ATCC BAA-835

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187735388|ref|YP_001877500.1|
Domain Number 1 Region: 3-179
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.27e-56
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.0000511
Further Details:      
 
Domain Number 2 Region: 187-322
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.75e-35
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187735388|ref|YP_001877500.1|
Sequence length 324
Comment transketolase [Akkermansia muciniphila ATCC BAA-835]
Sequence
MSVTYIDAIHDAQKDLLTEDRDVFLYGQDIGVFGGAFKATKGLKELFPDRVIDAPISEDA
MAGMVTGAAVMGKKPIMEVQFADFSTIAFNQIVNMAATHYYRTGIPANITVRLPCGGTPG
TGPFHSQSLEALFAHYPGLHVMTPATVADAYWMLRQAVEIPDPVIFLEHKFLYRWLKAED
NYREAPVIPFGTARIARTGKHATVVAYSAMVPEAVRAADLLEKESGYEVEVVDLRTVRPL
DMDTVIASVARTGRVLVVGEDFPWGGVTAEVVSRIVAEGFHLLDAPPQRLNARDTPIPQH
PNLWKAHRPTLESIAASIRHLLSI
Download sequence
Identical sequences A0A1Y3T0Q6 B2UQI4
gi|187735388|ref|YP_001877500.1| WP_012419934.1.11081 WP_012419934.1.13503 WP_012419934.1.26090 WP_012419934.1.31314 WP_012419934.1.44559 WP_012419934.1.48500 WP_012419934.1.52179 WP_012419934.1.55880 WP_012419934.1.65144 WP_012419934.1.67314 WP_012419934.1.75205 WP_012419934.1.86927 349741.Amuc_0886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]