SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|184155201|ref|YP_001843541.1| from Lactobacillus fermentum IFO 3956

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|184155201|ref|YP_001843541.1|
Domain Number 1 Region: 14-383
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.96e-123
Family ArgJ-like 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|184155201|ref|YP_001843541.1|
Sequence length 387
Comment bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein [Lactobacillus fermentum IFO 3956]
Sequence
MAQGFLCRRDTRWSEGRKKDLGWLYSKVPAAAAGVYTTNQFQAAPTKLTKQTVNLDHQLQ
AVVMNSANANSCTGPQGLVNAKTMQHLAAKKLGLTDQLVGVASTGIIGEPLPMDKITNGI
SQLSLTKSAAVTEAVLTTDKHPKSISVQFEFNNEPVIVTGFAKGSGMIHPKMATMLGFVT
TDAKIDGVALQQLLNQQVDETFNQITVDGDTSTNDMVLVLANGMAQTSPVTADPAGYALF
AAAFHQVLSFLAKSIAKDGEGATKLVEADVLHAYNHDEAQMVAKAIVGSNLVKAAIFGED
PNWGRLMGAIGQTKAHLDTNHVDVWLNDQPVVKDSQAYLIDPQVVASHLHENQVNVKVDL
HNGKALGQAWGCDLTYQYVKINASYHN
Download sequence
Identical sequences B2GBM9
gi|184155201|ref|YP_001843541.1| 334390.LAF_0725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]