SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|184155727|ref|YP_001844067.1| from Lactobacillus fermentum IFO 3956

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|184155727|ref|YP_001844067.1|
Domain Number 1 Region: 4-207
Classification Level Classification E-value
Superfamily Formyltransferase 3.14e-64
Family Formyltransferase 0.00000564
Further Details:      
 
Domain Number 2 Region: 206-304
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.75e-23
Family Post formyltransferase domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|184155727|ref|YP_001844067.1|
Sequence length 316
Comment methionyl-tRNA formyltransferase [Lactobacillus fermentum IFO 3956]
Sequence
MKSIVFMGTPQFAVPILKALIDSEDYQVLAVVSQPDRRVGRKRELRATPVKELALENGIE
VLTPEKINHSPEMDRVIELAPDLIITAAFGQFLPDKLLAAAKVAAINVHGSLLPKYRGGA
PIQYAVMNGDAETGVTIMYMVKKMDAGDIISQASLPITKQDDTGTMFEKLSLLGRDLLLD
TLPKLLAGDITPVKQDESQVVFSPNITREQETIDFTLPADRIDDLVRGLRPAPVGNMVID
GLRTKVYDVTPLTETTDLQPGQVVRVEKHALIIAAGAGTTYQINSLKPAGKPKMDITDYL
NGHQNLKPGVQAINND
Download sequence
Identical sequences A0A0F4HHV1 A0A0N7CJC3 B2GD55 C0X0A0 D0DV74 D8IIC8 R4RLI1 V4WZ49
gi|501675146|ref|YP_007995539.1| 334390.LAF_1251 WP_003683834.1.10140 WP_003683834.1.25573 WP_003683834.1.34248 WP_003683834.1.36713 WP_003683834.1.49422 WP_003683834.1.50778 WP_003683834.1.55334 WP_003683834.1.56007 WP_003683834.1.58986 WP_003683834.1.74232 WP_003683834.1.74320 WP_003683834.1.81600 WP_003683834.1.82607 WP_003683834.1.82755 WP_003683834.1.86783 WP_003683834.1.88712 WP_003683834.1.94331 WP_003683834.1.99973 gi|385812512|ref|YP_005848903.1| gi|184155727|ref|YP_001844067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]