SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170018668|ref|YP_001723622.1| from Escherichia coli ATCC 8739

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170018668|ref|YP_001723622.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.51e-109
Family FMN-linked oxidoreductases 0.00000000000868
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.95e-42
Family N-terminal domain of adrenodoxin reductase-like 0.0000003
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.45e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|170018668|ref|YP_001723622.1|
Sequence length 672
Comment NADH:flavin oxidoreductase [Escherichia coli ATCC 8739]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELSHEEILQLIDNFARCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRTPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A024LAK9 A0A069XTG7 A0A070SZA8 A0A0E0U3K8 A0A0E1M1T9 A0A0M7N533 A0A125WYN8 A0A140N7Z9 A0A142H6W0 A0A1X3II45 A0A1X3JCF3 A0A236ISF8 E3PJZ5 F4SN82 G0F5T8 H4UPD4 I2X5E0 M9G4J4 P42593 S1ECI6 T9CMY7 U9ZR04 V0A0S0
gi|16130976|ref|NP_417552.1| gi|254163027|ref|YP_003046135.1| gi|387622749|ref|YP_006130377.1| NP_417552.1.90541 WP_000121433.1.100085 WP_000121433.1.100111 WP_000121433.1.100251 WP_000121433.1.10034 WP_000121433.1.100441 WP_000121433.1.100487 WP_000121433.1.10051 WP_000121433.1.100614 WP_000121433.1.100685 WP_000121433.1.100824 WP_000121433.1.100966 WP_000121433.1.101033 WP_000121433.1.101282 WP_000121433.1.101423 WP_000121433.1.101654 WP_000121433.1.101737 WP_000121433.1.101747 WP_000121433.1.10188 WP_000121433.1.101908 WP_000121433.1.10252 WP_000121433.1.1040 WP_000121433.1.10417 WP_000121433.1.10496 WP_000121433.1.1058 WP_000121433.1.10729 WP_000121433.1.11047 WP_000121433.1.1113 WP_000121433.1.11436 WP_000121433.1.11844 WP_000121433.1.11982 WP_000121433.1.12060 WP_000121433.1.1212 WP_000121433.1.12542 WP_000121433.1.12558 WP_000121433.1.12574 WP_000121433.1.12582 WP_000121433.1.12697 WP_000121433.1.127 WP_000121433.1.12756 WP_000121433.1.12775 WP_000121433.1.13002 WP_000121433.1.13031 WP_000121433.1.1312 WP_000121433.1.13136 WP_000121433.1.1314 WP_000121433.1.13176 WP_000121433.1.13239 WP_000121433.1.13281 WP_000121433.1.13290 WP_000121433.1.13295 WP_000121433.1.13333 WP_000121433.1.1345 WP_000121433.1.13585 WP_000121433.1.13618 WP_000121433.1.13672 WP_000121433.1.13949 WP_000121433.1.14030 WP_000121433.1.1419 WP_000121433.1.14277 WP_000121433.1.14292 WP_000121433.1.1438 WP_000121433.1.14468 WP_000121433.1.14501 WP_000121433.1.1461 WP_000121433.1.14811 WP_000121433.1.14833 WP_000121433.1.14871 WP_000121433.1.14992 WP_000121433.1.1512 WP_000121433.1.15259 WP_000121433.1.15576 WP_000121433.1.15645 WP_000121433.1.15740 WP_000121433.1.15747 WP_000121433.1.1588 WP_000121433.1.15951 WP_000121433.1.16086 WP_000121433.1.1609 WP_000121433.1.16102 WP_000121433.1.16111 WP_000121433.1.16294 WP_000121433.1.1634 WP_000121433.1.16532 WP_000121433.1.16541 WP_000121433.1.16577 WP_000121433.1.16715 WP_000121433.1.17018 WP_000121433.1.17087 WP_000121433.1.17114 WP_000121433.1.17119 WP_000121433.1.17216 WP_000121433.1.17282 WP_000121433.1.17360 WP_000121433.1.17432 WP_000121433.1.17534 WP_000121433.1.1755 WP_000121433.1.17889 WP_000121433.1.17952 WP_000121433.1.18133 WP_000121433.1.18381 WP_000121433.1.18402 WP_000121433.1.18858 WP_000121433.1.19075 WP_000121433.1.19150 WP_000121433.1.19194 WP_000121433.1.19205 WP_000121433.1.19277 WP_000121433.1.193 WP_000121433.1.19313 WP_000121433.1.19361 WP_000121433.1.1963 WP_000121433.1.19684 WP_000121433.1.19795 WP_000121433.1.19889 WP_000121433.1.19957 WP_000121433.1.20151 WP_000121433.1.20164 WP_000121433.1.20308 WP_000121433.1.20331 WP_000121433.1.20445 WP_000121433.1.20506 WP_000121433.1.20536 WP_000121433.1.20638 WP_000121433.1.20943 WP_000121433.1.20982 WP_000121433.1.2100 WP_000121433.1.21017 WP_000121433.1.21033 WP_000121433.1.21057 WP_000121433.1.21122 WP_000121433.1.21251 WP_000121433.1.21255 WP_000121433.1.2142 WP_000121433.1.2156 WP_000121433.1.21573 WP_000121433.1.21661 WP_000121433.1.21771 WP_000121433.1.21823 WP_000121433.1.2198 WP_000121433.1.22113 WP_000121433.1.22359 WP_000121433.1.22363 WP_000121433.1.22574 WP_000121433.1.22579 WP_000121433.1.22632 WP_000121433.1.22649 WP_000121433.1.22669 WP_000121433.1.22690 WP_000121433.1.22830 WP_000121433.1.22878 WP_000121433.1.2300 WP_000121433.1.23044 WP_000121433.1.23090 WP_000121433.1.23378 WP_000121433.1.23511 WP_000121433.1.23549 WP_000121433.1.2362 WP_000121433.1.23812 WP_000121433.1.23898 WP_000121433.1.23945 WP_000121433.1.24089 WP_000121433.1.24124 WP_000121433.1.2428 WP_000121433.1.24316 WP_000121433.1.24583 WP_000121433.1.24616 WP_000121433.1.24876 WP_000121433.1.24899 WP_000121433.1.25085 WP_000121433.1.25203 WP_000121433.1.25312 WP_000121433.1.25324 WP_000121433.1.25525 WP_000121433.1.25713 WP_000121433.1.25750 WP_000121433.1.25843 WP_000121433.1.26048 WP_000121433.1.26379 WP_000121433.1.26480 WP_000121433.1.26588 WP_000121433.1.26609 WP_000121433.1.27098 WP_000121433.1.27134 WP_000121433.1.27214 WP_000121433.1.27260 WP_000121433.1.27560 WP_000121433.1.27742 WP_000121433.1.27879 WP_000121433.1.27923 WP_000121433.1.27971 WP_000121433.1.28128 WP_000121433.1.28268 WP_000121433.1.28271 WP_000121433.1.28371 WP_000121433.1.28509 WP_000121433.1.28662 WP_000121433.1.28697 WP_000121433.1.28711 WP_000121433.1.28760 WP_000121433.1.28809 WP_000121433.1.28919 WP_000121433.1.28994 WP_000121433.1.29016 WP_000121433.1.29061 WP_000121433.1.29100 WP_000121433.1.29221 WP_000121433.1.2942 WP_000121433.1.2995 WP_000121433.1.29967 WP_000121433.1.30004 WP_000121433.1.30231 WP_000121433.1.30247 WP_000121433.1.3045 WP_000121433.1.30472 WP_000121433.1.30479 WP_000121433.1.30497 WP_000121433.1.30554 WP_000121433.1.30630 WP_000121433.1.30749 WP_000121433.1.30866 WP_000121433.1.31000 WP_000121433.1.31379 WP_000121433.1.31421 WP_000121433.1.31506 WP_000121433.1.3169 WP_000121433.1.31833 WP_000121433.1.31839 WP_000121433.1.31978 WP_000121433.1.32093 WP_000121433.1.3212 WP_000121433.1.32121 WP_000121433.1.32143 WP_000121433.1.32479 WP_000121433.1.32722 WP_000121433.1.32903 WP_000121433.1.32984 WP_000121433.1.33244 WP_000121433.1.334 WP_000121433.1.33424 WP_000121433.1.33526 WP_000121433.1.33565 WP_000121433.1.33648 WP_000121433.1.33736 WP_000121433.1.33799 WP_000121433.1.33879 WP_000121433.1.33888 WP_000121433.1.33952 WP_000121433.1.3401 WP_000121433.1.34124 WP_000121433.1.34270 WP_000121433.1.34277 WP_000121433.1.34332 WP_000121433.1.34363 WP_000121433.1.34441 WP_000121433.1.34538 WP_000121433.1.347 WP_000121433.1.34838 WP_000121433.1.34990 WP_000121433.1.34993 WP_000121433.1.35204 WP_000121433.1.35211 WP_000121433.1.35466 WP_000121433.1.35704 WP_000121433.1.35740 WP_000121433.1.35904 WP_000121433.1.36164 WP_000121433.1.3620 WP_000121433.1.36334 WP_000121433.1.36386 WP_000121433.1.36453 WP_000121433.1.36627 WP_000121433.1.36739 WP_000121433.1.36746 WP_000121433.1.36747 WP_000121433.1.36833 WP_000121433.1.37122 WP_000121433.1.3723 WP_000121433.1.37233 WP_000121433.1.37261 WP_000121433.1.37433 WP_000121433.1.37445 WP_000121433.1.37576 WP_000121433.1.37588 WP_000121433.1.3788 WP_000121433.1.37897 WP_000121433.1.37964 WP_000121433.1.38080 WP_000121433.1.38105 WP_000121433.1.3811 WP_000121433.1.3815 WP_000121433.1.38155 WP_000121433.1.38182 WP_000121433.1.38211 WP_000121433.1.38323 WP_000121433.1.38485 WP_000121433.1.38636 WP_000121433.1.38956 WP_000121433.1.39164 WP_000121433.1.39167 WP_000121433.1.39356 WP_000121433.1.39365 WP_000121433.1.39367 WP_000121433.1.39430 WP_000121433.1.39709 WP_000121433.1.39870 WP_000121433.1.39961 WP_000121433.1.39966 WP_000121433.1.40013 WP_000121433.1.40192 WP_000121433.1.40212 WP_000121433.1.40218 WP_000121433.1.40317 WP_000121433.1.40389 WP_000121433.1.40499 WP_000121433.1.40548 WP_000121433.1.406 WP_000121433.1.40712 WP_000121433.1.40815 WP_000121433.1.40833 WP_000121433.1.40898 WP_000121433.1.40912 WP_000121433.1.41206 WP_000121433.1.41484 WP_000121433.1.41530 WP_000121433.1.41556 WP_000121433.1.41621 WP_000121433.1.41782 WP_000121433.1.41813 WP_000121433.1.41900 WP_000121433.1.42022 WP_000121433.1.42033 WP_000121433.1.42113 WP_000121433.1.42214 WP_000121433.1.42318 WP_000121433.1.42376 WP_000121433.1.42432 WP_000121433.1.42547 WP_000121433.1.42632 WP_000121433.1.42770 WP_000121433.1.4282 WP_000121433.1.42879 WP_000121433.1.42936 WP_000121433.1.4306 WP_000121433.1.43174 WP_000121433.1.43270 WP_000121433.1.43444 WP_000121433.1.43473 WP_000121433.1.43489 WP_000121433.1.43989 WP_000121433.1.44088 WP_000121433.1.44096 WP_000121433.1.44100 WP_000121433.1.44115 WP_000121433.1.44162 WP_000121433.1.44166 WP_000121433.1.44324 WP_000121433.1.44365 WP_000121433.1.44558 WP_000121433.1.44849 WP_000121433.1.44854 WP_000121433.1.44923 WP_000121433.1.44970 WP_000121433.1.44977 WP_000121433.1.44980 WP_000121433.1.45025 WP_000121433.1.45028 WP_000121433.1.45043 WP_000121433.1.45116 WP_000121433.1.45329 WP_000121433.1.45741 WP_000121433.1.4593 WP_000121433.1.45933 WP_000121433.1.46026 WP_000121433.1.46186 WP_000121433.1.46217 WP_000121433.1.46325 WP_000121433.1.46329 WP_000121433.1.46441 WP_000121433.1.46487 WP_000121433.1.46582 WP_000121433.1.4670 WP_000121433.1.46802 WP_000121433.1.46909 WP_000121433.1.46932 WP_000121433.1.47038 WP_000121433.1.47048 WP_000121433.1.47156 WP_000121433.1.47186 WP_000121433.1.4722 WP_000121433.1.47224 WP_000121433.1.47414 WP_000121433.1.47496 WP_000121433.1.47634 WP_000121433.1.47646 WP_000121433.1.47673 WP_000121433.1.4772 WP_000121433.1.47734 WP_000121433.1.47765 WP_000121433.1.47791 WP_000121433.1.48080 WP_000121433.1.48194 WP_000121433.1.48290 WP_000121433.1.48353 WP_000121433.1.486 WP_000121433.1.4871 WP_000121433.1.48847 WP_000121433.1.48860 WP_000121433.1.48953 WP_000121433.1.48974 WP_000121433.1.49009 WP_000121433.1.49531 WP_000121433.1.49537 WP_000121433.1.49645 WP_000121433.1.49661 WP_000121433.1.49733 WP_000121433.1.49768 WP_000121433.1.49900 WP_000121433.1.50006 WP_000121433.1.50008 WP_000121433.1.50078 WP_000121433.1.5017 WP_000121433.1.50579 WP_000121433.1.5067 WP_000121433.1.51042 WP_000121433.1.51172 WP_000121433.1.51255 WP_000121433.1.51300 WP_000121433.1.5146 WP_000121433.1.51495 WP_000121433.1.5153 WP_000121433.1.51552 WP_000121433.1.51587 WP_000121433.1.51607 WP_000121433.1.51784 WP_000121433.1.51968 WP_000121433.1.52020 WP_000121433.1.52062 WP_000121433.1.52076 WP_000121433.1.52211 WP_000121433.1.52214 WP_000121433.1.52243 WP_000121433.1.52258 WP_000121433.1.52305 WP_000121433.1.52399 WP_000121433.1.52421 WP_000121433.1.52492 WP_000121433.1.52544 WP_000121433.1.52558 WP_000121433.1.5265 WP_000121433.1.52774 WP_000121433.1.52844 WP_000121433.1.52853 WP_000121433.1.52895 WP_000121433.1.53012 WP_000121433.1.53020 WP_000121433.1.53110 WP_000121433.1.53327 WP_000121433.1.53377 WP_000121433.1.53428 WP_000121433.1.53482 WP_000121433.1.53594 WP_000121433.1.53645 WP_000121433.1.53769 WP_000121433.1.53931 WP_000121433.1.53972 WP_000121433.1.54002 WP_000121433.1.54329 WP_000121433.1.54344 WP_000121433.1.54411 WP_000121433.1.54463 WP_000121433.1.54476 WP_000121433.1.54507 WP_000121433.1.54602 WP_000121433.1.54605 WP_000121433.1.5461 WP_000121433.1.54617 WP_000121433.1.54625 WP_000121433.1.5470 WP_000121433.1.54769 WP_000121433.1.54981 WP_000121433.1.55003 WP_000121433.1.55005 WP_000121433.1.55112 WP_000121433.1.55123 WP_000121433.1.55203 WP_000121433.1.55425 WP_000121433.1.55529 WP_000121433.1.55551 WP_000121433.1.55556 WP_000121433.1.55571 WP_000121433.1.55574 WP_000121433.1.55608 WP_000121433.1.55629 WP_000121433.1.55720 WP_000121433.1.55825 WP_000121433.1.55868 WP_000121433.1.5614 WP_000121433.1.56164 WP_000121433.1.56285 WP_000121433.1.56293 WP_000121433.1.56786 WP_000121433.1.56846 WP_000121433.1.57159 WP_000121433.1.57181 WP_000121433.1.57401 WP_000121433.1.57403 WP_000121433.1.57410 WP_000121433.1.57414 WP_000121433.1.5742 WP_000121433.1.57432 WP_000121433.1.5786 WP_000121433.1.57994 WP_000121433.1.58060 WP_000121433.1.58232 WP_000121433.1.58316 WP_000121433.1.58384 WP_000121433.1.58429 WP_000121433.1.58837 WP_000121433.1.58867 WP_000121433.1.58940 WP_000121433.1.58958 WP_000121433.1.59024 WP_000121433.1.59026 WP_000121433.1.59047 WP_000121433.1.59306 WP_000121433.1.59513 WP_000121433.1.59553 WP_000121433.1.59615 WP_000121433.1.5965 WP_000121433.1.59998 WP_000121433.1.6002 WP_000121433.1.60031 WP_000121433.1.60343 WP_000121433.1.60498 WP_000121433.1.60550 WP_000121433.1.60555 WP_000121433.1.6061 WP_000121433.1.6066 WP_000121433.1.6068 WP_000121433.1.60717 WP_000121433.1.60895 WP_000121433.1.61006 WP_000121433.1.6106 WP_000121433.1.61102 WP_000121433.1.61132 WP_000121433.1.61170 WP_000121433.1.61183 WP_000121433.1.61241 WP_000121433.1.61517 WP_000121433.1.61663 WP_000121433.1.61822 WP_000121433.1.62099 WP_000121433.1.62612 WP_000121433.1.62631 WP_000121433.1.62787 WP_000121433.1.62812 WP_000121433.1.62840 WP_000121433.1.62919 WP_000121433.1.62989 WP_000121433.1.63167 WP_000121433.1.63246 WP_000121433.1.6337 WP_000121433.1.63453 WP_000121433.1.63478 WP_000121433.1.64040 WP_000121433.1.64080 WP_000121433.1.6416 WP_000121433.1.64285 WP_000121433.1.6431 WP_000121433.1.64448 WP_000121433.1.647 WP_000121433.1.64784 WP_000121433.1.64789 WP_000121433.1.64912 WP_000121433.1.65271 WP_000121433.1.65596 WP_000121433.1.65961 WP_000121433.1.66050 WP_000121433.1.66104 WP_000121433.1.66105 WP_000121433.1.66280 WP_000121433.1.66327 WP_000121433.1.6635 WP_000121433.1.66387 WP_000121433.1.66389 WP_000121433.1.66395 WP_000121433.1.66448 WP_000121433.1.66501 WP_000121433.1.6654 WP_000121433.1.66624 WP_000121433.1.6665 WP_000121433.1.66700 WP_000121433.1.66719 WP_000121433.1.66794 WP_000121433.1.67137 WP_000121433.1.67200 WP_000121433.1.67293 WP_000121433.1.67468 WP_000121433.1.67553 WP_000121433.1.67660 WP_000121433.1.67732 WP_000121433.1.67787 WP_000121433.1.67853 WP_000121433.1.67861 WP_000121433.1.67990 WP_000121433.1.68008 WP_000121433.1.68170 WP_000121433.1.68215 WP_000121433.1.68697 WP_000121433.1.68711 WP_000121433.1.68797 WP_000121433.1.68989 WP_000121433.1.69127 WP_000121433.1.6916 WP_000121433.1.69261 WP_000121433.1.69305 WP_000121433.1.6945 WP_000121433.1.69473 WP_000121433.1.69646 WP_000121433.1.69803 WP_000121433.1.70407 WP_000121433.1.70767 WP_000121433.1.70794 WP_000121433.1.70880 WP_000121433.1.71024 WP_000121433.1.71159 WP_000121433.1.71199 WP_000121433.1.71229 WP_000121433.1.71272 WP_000121433.1.71312 WP_000121433.1.71397 WP_000121433.1.71403 WP_000121433.1.71405 WP_000121433.1.71409 WP_000121433.1.71421 WP_000121433.1.71480 WP_000121433.1.71632 WP_000121433.1.71690 WP_000121433.1.71783 WP_000121433.1.71837 WP_000121433.1.71944 WP_000121433.1.71975 WP_000121433.1.72157 WP_000121433.1.72184 WP_000121433.1.72237 WP_000121433.1.72248 WP_000121433.1.72279 WP_000121433.1.72397 WP_000121433.1.72431 WP_000121433.1.72485 WP_000121433.1.72511 WP_000121433.1.72537 WP_000121433.1.72606 WP_000121433.1.72745 WP_000121433.1.72860 WP_000121433.1.72910 WP_000121433.1.73085 WP_000121433.1.73129 WP_000121433.1.73217 WP_000121433.1.73292 WP_000121433.1.73295 WP_000121433.1.73524 WP_000121433.1.73565 WP_000121433.1.73604 WP_000121433.1.73717 WP_000121433.1.7376 WP_000121433.1.73835 WP_000121433.1.73843 WP_000121433.1.73844 WP_000121433.1.73859 WP_000121433.1.73942 WP_000121433.1.74123 WP_000121433.1.74309 WP_000121433.1.74365 WP_000121433.1.74445 WP_000121433.1.74520 WP_000121433.1.74528 WP_000121433.1.7461 WP_000121433.1.74625 WP_000121433.1.74691 WP_000121433.1.74713 WP_000121433.1.7475 WP_000121433.1.74998 WP_000121433.1.75139 WP_000121433.1.75145 WP_000121433.1.75149 WP_000121433.1.75209 WP_000121433.1.75243 WP_000121433.1.75306 WP_000121433.1.75367 WP_000121433.1.75491 WP_000121433.1.75537 WP_000121433.1.75612 WP_000121433.1.75644 WP_000121433.1.75679 WP_000121433.1.75687 WP_000121433.1.75995 WP_000121433.1.76196 WP_000121433.1.76361 WP_000121433.1.76446 WP_000121433.1.76462 WP_000121433.1.76562 WP_000121433.1.76909 WP_000121433.1.77214 WP_000121433.1.77291 WP_000121433.1.77358 WP_000121433.1.77470 WP_000121433.1.77595 WP_000121433.1.77636 WP_000121433.1.77648 WP_000121433.1.77768 WP_000121433.1.78007 WP_000121433.1.78089 WP_000121433.1.78196 WP_000121433.1.78321 WP_000121433.1.78413 WP_000121433.1.7847 WP_000121433.1.78481 WP_000121433.1.78583 WP_000121433.1.78791 WP_000121433.1.78953 WP_000121433.1.7896 WP_000121433.1.79004 WP_000121433.1.79086 WP_000121433.1.79246 WP_000121433.1.79312 WP_000121433.1.79558 WP_000121433.1.79685 WP_000121433.1.79764 WP_000121433.1.7985 WP_000121433.1.7987 WP_000121433.1.79871 WP_000121433.1.79931 WP_000121433.1.79984 WP_000121433.1.80050 WP_000121433.1.80060 WP_000121433.1.80320 WP_000121433.1.80428 WP_000121433.1.80440 WP_000121433.1.80524 WP_000121433.1.8057 WP_000121433.1.80626 WP_000121433.1.80662 WP_000121433.1.80666 WP_000121433.1.80804 WP_000121433.1.80805 WP_000121433.1.8090 WP_000121433.1.81034 WP_000121433.1.81054 WP_000121433.1.81286 WP_000121433.1.81313 WP_000121433.1.81589 WP_000121433.1.81618 WP_000121433.1.81715 WP_000121433.1.81723 WP_000121433.1.81806 WP_000121433.1.81832 WP_000121433.1.82275 WP_000121433.1.8235 WP_000121433.1.82700 WP_000121433.1.82715 WP_000121433.1.83020 WP_000121433.1.8308 WP_000121433.1.83097 WP_000121433.1.83140 WP_000121433.1.83144 WP_000121433.1.83224 WP_000121433.1.8345 WP_000121433.1.83735 WP_000121433.1.83941 WP_000121433.1.8411 WP_000121433.1.84331 WP_000121433.1.84405 WP_000121433.1.84410 WP_000121433.1.8444 WP_000121433.1.84534 WP_000121433.1.84584 WP_000121433.1.84738 WP_000121433.1.84740 WP_000121433.1.84875 WP_000121433.1.84977 WP_000121433.1.84989 WP_000121433.1.85002 WP_000121433.1.85216 WP_000121433.1.85255 WP_000121433.1.85310 WP_000121433.1.85323 WP_000121433.1.85500 WP_000121433.1.85621 WP_000121433.1.85752 WP_000121433.1.85857 WP_000121433.1.8592 WP_000121433.1.85948 WP_000121433.1.86016 WP_000121433.1.86161 WP_000121433.1.8621 WP_000121433.1.86412 WP_000121433.1.86452 WP_000121433.1.86461 WP_000121433.1.86475 WP_000121433.1.86691 WP_000121433.1.86787 WP_000121433.1.86788 WP_000121433.1.86848 WP_000121433.1.86959 WP_000121433.1.87199 WP_000121433.1.87389 WP_000121433.1.87563 WP_000121433.1.87574 WP_000121433.1.87655 WP_000121433.1.87914 WP_000121433.1.88017 WP_000121433.1.88301 WP_000121433.1.88304 WP_000121433.1.88434 WP_000121433.1.88607 WP_000121433.1.88729 WP_000121433.1.88757 WP_000121433.1.88834 WP_000121433.1.88950 WP_000121433.1.89099 WP_000121433.1.89416 WP_000121433.1.89458 WP_000121433.1.89468 WP_000121433.1.89679 WP_000121433.1.89923 WP_000121433.1.90017 WP_000121433.1.90078 WP_000121433.1.90358 WP_000121433.1.9036 WP_000121433.1.90389 WP_000121433.1.90511 WP_000121433.1.90520 WP_000121433.1.90536 WP_000121433.1.90828 WP_000121433.1.90951 WP_000121433.1.91007 WP_000121433.1.91170 WP_000121433.1.91277 WP_000121433.1.91340 WP_000121433.1.91341 WP_000121433.1.915 WP_000121433.1.9169 WP_000121433.1.91850 WP_000121433.1.91994 WP_000121433.1.9215 WP_000121433.1.92161 WP_000121433.1.92361 WP_000121433.1.92568 WP_000121433.1.92615 WP_000121433.1.92708 WP_000121433.1.92742 WP_000121433.1.92792 WP_000121433.1.92845 WP_000121433.1.92865 WP_000121433.1.92943 WP_000121433.1.93019 WP_000121433.1.93054 WP_000121433.1.93167 WP_000121433.1.93233 WP_000121433.1.93276 WP_000121433.1.9356 WP_000121433.1.93629 WP_000121433.1.93755 WP_000121433.1.93952 WP_000121433.1.93971 WP_000121433.1.94025 WP_000121433.1.94057 WP_000121433.1.94176 WP_000121433.1.94187 WP_000121433.1.94271 WP_000121433.1.94388 WP_000121433.1.94445 WP_000121433.1.94542 WP_000121433.1.9457 WP_000121433.1.94692 WP_000121433.1.94738 WP_000121433.1.948 WP_000121433.1.94898 WP_000121433.1.94938 WP_000121433.1.94949 WP_000121433.1.94993 WP_000121433.1.95037 WP_000121433.1.95395 WP_000121433.1.95595 WP_000121433.1.95827 WP_000121433.1.95849 WP_000121433.1.95919 WP_000121433.1.95932 WP_000121433.1.96215 WP_000121433.1.96263 WP_000121433.1.96299 WP_000121433.1.96339 WP_000121433.1.96394 WP_000121433.1.96417 WP_000121433.1.96984 WP_000121433.1.97119 WP_000121433.1.97123 WP_000121433.1.97418 WP_000121433.1.9747 WP_000121433.1.97677 WP_000121433.1.97825 WP_000121433.1.97930 WP_000121433.1.97982 WP_000121433.1.97996 WP_000121433.1.98220 WP_000121433.1.98235 WP_000121433.1.98355 WP_000121433.1.98424 WP_000121433.1.98442 WP_000121433.1.98477 WP_000121433.1.98578 WP_000121433.1.98614 WP_000121433.1.98628 WP_000121433.1.9864 WP_000121433.1.98776 WP_000121433.1.99265 WP_000121433.1.99392 WP_000121433.1.99400 WP_000121433.1.99602 WP_000121433.1.99603 WP_000121433.1.99698 WP_000121433.1.99891 gi|251786356|ref|YP_003000660.1| gi|387622749|ref|YP_006130377.1| gi|387613775|ref|YP_006116891.1| gi|386615868|ref|YP_006135534.1| gi|170082623|ref|YP_001731943.1| gi|251786356|ref|YP_003000660.1| gi|388479080|ref|YP_491272.1| 316385.ECDH10B_3256 316407.fadH 413997.ECB_02950 469008.ECBD_0661 481805.EcolC_0619 511145.b3081 595496.BWG_2791 gi|386706351|ref|YP_006170198.1| gi|170018668|ref|YP_001723622.1| gi|471334648|ref|YP_007558125.1| gi|238902191|ref|YP_002927987.1| gi|253772084|ref|YP_003034915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]