SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|170021647|ref|YP_001726601.1| from Escherichia coli ATCC 8739

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|170021647|ref|YP_001726601.1|
Domain Number 1 Region: 5-105
Classification Level Classification E-value
Superfamily TrpR-like 9.52e-30
Family Trp repressor, TrpR 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|170021647|ref|YP_001726601.1|
Sequence length 108
Comment Trp operon repressor [Escherichia coli ATCC 8739]
Sequence
MAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEE
LLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD
Download sequence
Identical sequences A0A024KMH5 A0A026V626 A0A027U2V6 A0A028AG72 A0A028DN86 A0A062Y2U1 A0A070F9B2 A0A070ST04 A0A070UWR6 A0A073FX35 A0A074HGU2 A0A080FLY2 A0A080I8I6 A0A090NNM5 A0A0A0F781 A0A0E0U7K2 A0A0E0Y5L3 A0A0E1SU09 A0A0E2TRY1 A0A0F6CCX4 A0A0F6FGJ7 A0A0F6MKB2 A0A0H3PW77 A0A0I1BX92 A0A0R5RPJ1 A0A127GTA2 A0A127SGG4 A0A140NEE9 A0A142GYU7 A0A1E2VL28 A0A1Q8NY46 A0A1S6TJU4 A0A1W2MBW4 A0A1X3IGK2 A0A1X3J7G5 A0A1X3JMD2 A0A1X3L8P0 A0A1X3LB98 A0A1Z3UVB3 A0A226K4L4 A0A236LXG0 A0A2H1BQ03 A7ZVT5 A8A8C2 B1IS26 B1XFK3 B2TZS6 B5Z4S5 B6I6P1 B7LEN9 B7LXV6 C3SE17 C4ZT75 C8U165 C8UNA0 D2AFE6 D3GY33 D3QNF3 D6I4P1 D6IHV1 D7XQS0 D7Y2X5 D8ECP2 E1IRT6 E1J5B5 E2XD86 E3PFH5 E6BJB4 E7SEX6 E7T5R6 E7THV7 E9TCI9 F3V0W0 F4NLJ2 F4SEY8 F4T9G1 F4VN71 F5MWW7 F5P4B8 G0FAU3 G1UE40 H4UT96 I0VYN4 I2RU20 I2SL56 I2UPX8 I2W7Z9 I2WSH0 I2X8H6 I4T5Z7 I6D914 I6F152 J7QV94 K0XY25 K4XKZ8 K4Y793 M9HFH7 P0A881 P0A882 P0A883 Q0SX19 Q31SU5 Q327K2 Q3YU01 U9XPZ3 U9XRG8 V0A4W6 V6G295 V8FBY7 W0FTA5 W1B5V1 W1EZB4
gi|209400910|ref|YP_002273914.1| gi|251787641|ref|YP_003001945.1| gi|209921860|ref|YP_002295944.1| cath|current|3wrpA00/8-108 gi|16132210|ref|NP_418810.1| gi|384545943|ref|YP_005730007.1| gi|383181714|ref|YP_005459719.1| gi|15804964|ref|NP_291006.1| gi|387615164|ref|YP_006118281.1| gi|260847283|ref|YP_003225061.1| gi|157156215|ref|YP_001465914.1| gi|254164319|ref|YP_003047429.1| 3wrp_A 5tm0_A 5tm0_B 5tm0_C 5tm0_D gi|251787641|ref|YP_003001945.1| gi|386712333|ref|YP_006176054.1| gi|407467452|ref|YP_006786106.1| 155864.Z5995 198214.SF4425 300267.SDY_4654 300268.SBO_4456 300269.SSON_4543 316385.ECDH10B_4551 316407.trpR 331111.EcE24377A_4992 331112.EcHS_A4629 344609.SbBS512_E4941 373384.SFV_4427 386585.ECs5351 409438.ECSE_4669 413997.ECB_04269 444450.ECH74115_5908 469008.ECBD_3627 481805.EcolC_3663 511145.b4393 544404.ECSP_5476 573235.ECO26_5599 585034.ECIAI1_4617 585055.EC55989_5055 585395.ECO103_5254 585396.ECO111_5254 595496.BWG_4085 gi|170021647|ref|YP_001726601.1| gi|110808181|ref|YP_691701.1| gi|291285828|ref|YP_003502646.1| gi|410484371|ref|YP_006771917.1| gi|388480328|ref|YP_492523.1| gi|15834605|ref|NP_313378.1| gi|253774977|ref|YP_003037808.1| gi|260871115|ref|YP_003237517.1| gi|387610270|ref|YP_006099128.1| gi|378714662|ref|YP_005279555.1| gi|82546744|ref|YP_410691.1| gi|218698229|ref|YP_002405896.1| gi|187730268|ref|YP_001883057.1| gi|378714662|ref|YP_005279555.1| gi|386712333|ref|YP_006176054.1| gi|254796389|ref|YP_003081226.1| gi|544392763|ref|YP_008567608.1| gi|74314827|ref|YP_313246.1| NP_313378.1.58667 NP_418810.1.90541 NP_710132.1.23235 WP_000068679.1.1000 WP_000068679.1.10001 WP_000068679.1.100014 WP_000068679.1.100044 WP_000068679.1.100063 WP_000068679.1.100066 WP_000068679.1.100073 WP_000068679.1.100085 WP_000068679.1.10010 WP_000068679.1.100111 WP_000068679.1.100116 WP_000068679.1.100135 WP_000068679.1.100159 WP_000068679.1.100185 WP_000068679.1.100251 WP_000068679.1.100252 WP_000068679.1.100299 WP_000068679.1.100302 WP_000068679.1.100304 WP_000068679.1.100315 WP_000068679.1.10034 WP_000068679.1.100389 WP_000068679.1.100425 WP_000068679.1.100441 WP_000068679.1.100444 WP_000068679.1.100447 WP_000068679.1.100448 WP_000068679.1.100451 WP_000068679.1.10048 WP_000068679.1.100487 WP_000068679.1.100496 WP_000068679.1.100499 WP_000068679.1.100508 WP_000068679.1.10051 WP_000068679.1.100543 WP_000068679.1.100554 WP_000068679.1.100571 WP_000068679.1.100573 WP_000068679.1.100614 WP_000068679.1.100667 WP_000068679.1.10067 WP_000068679.1.10068 WP_000068679.1.100689 WP_000068679.1.100718 WP_000068679.1.100725 WP_000068679.1.100735 WP_000068679.1.100738 WP_000068679.1.100752 WP_000068679.1.100753 WP_000068679.1.100758 WP_000068679.1.100778 WP_000068679.1.100796 WP_000068679.1.10080 WP_000068679.1.100824 WP_000068679.1.100836 WP_000068679.1.100851 WP_000068679.1.100852 WP_000068679.1.10086 WP_000068679.1.100867 WP_000068679.1.100868 WP_000068679.1.100898 WP_000068679.1.100925 WP_000068679.1.100928 WP_000068679.1.100933 WP_000068679.1.10094 WP_000068679.1.100990 WP_000068679.1.101033 WP_000068679.1.101096 WP_000068679.1.1011 WP_000068679.1.101102 WP_000068679.1.101105 WP_000068679.1.101121 WP_000068679.1.101157 WP_000068679.1.101166 WP_000068679.1.101175 WP_000068679.1.101186 WP_000068679.1.101206 WP_000068679.1.101214 WP_000068679.1.101255 WP_000068679.1.101257 WP_000068679.1.10126 WP_000068679.1.101282 WP_000068679.1.101293 WP_000068679.1.101313 WP_000068679.1.101359 WP_000068679.1.101387 WP_000068679.1.101418 WP_000068679.1.101423 WP_000068679.1.101436 WP_000068679.1.101468 WP_000068679.1.101486 WP_000068679.1.101518 WP_000068679.1.101522 WP_000068679.1.10154 WP_000068679.1.101545 WP_000068679.1.101583 WP_000068679.1.101594 WP_000068679.1.101628 WP_000068679.1.101630 WP_000068679.1.101651 WP_000068679.1.101653 WP_000068679.1.101654 WP_000068679.1.101667 WP_000068679.1.101668 WP_000068679.1.101686 WP_000068679.1.10173 WP_000068679.1.101737 WP_000068679.1.101747 WP_000068679.1.101777 WP_000068679.1.101786 WP_000068679.1.101822 WP_000068679.1.10184 WP_000068679.1.101840 WP_000068679.1.101845 WP_000068679.1.101865 WP_000068679.1.10187 WP_000068679.1.10188 WP_000068679.1.101887 WP_000068679.1.101889 WP_000068679.1.10190 WP_000068679.1.101900 WP_000068679.1.101908 WP_000068679.1.101913 WP_000068679.1.101937 WP_000068679.1.101940 WP_000068679.1.101942 WP_000068679.1.101947 WP_000068679.1.101952 WP_000068679.1.101969 WP_000068679.1.101977 WP_000068679.1.101987 WP_000068679.1.102021 WP_000068679.1.10206 WP_000068679.1.102069 WP_000068679.1.102093 WP_000068679.1.102094 WP_000068679.1.102122 WP_000068679.1.102139 WP_000068679.1.102144 WP_000068679.1.10222 WP_000068679.1.10226 WP_000068679.1.10233 WP_000068679.1.10235 WP_000068679.1.10252 WP_000068679.1.10273 WP_000068679.1.10326 WP_000068679.1.10329 WP_000068679.1.10335 WP_000068679.1.10348 WP_000068679.1.10352 WP_000068679.1.10361 WP_000068679.1.10379 WP_000068679.1.10400 WP_000068679.1.10417 WP_000068679.1.10461 WP_000068679.1.10476 WP_000068679.1.10491 WP_000068679.1.10496 WP_000068679.1.10508 WP_000068679.1.10525 WP_000068679.1.10538 WP_000068679.1.10569 WP_000068679.1.10576 WP_000068679.1.10579 WP_000068679.1.1058 WP_000068679.1.10607 WP_000068679.1.10628 WP_000068679.1.10651 WP_000068679.1.10673 WP_000068679.1.1071 WP_000068679.1.10715 WP_000068679.1.10729 WP_000068679.1.1073 WP_000068679.1.1074 WP_000068679.1.10761 WP_000068679.1.10763 WP_000068679.1.10771 WP_000068679.1.10786 WP_000068679.1.10798 WP_000068679.1.10833 WP_000068679.1.10849 WP_000068679.1.10862 WP_000068679.1.10922 WP_000068679.1.10940 WP_000068679.1.10970 WP_000068679.1.10988 WP_000068679.1.10989 WP_000068679.1.10994 WP_000068679.1.10995 WP_000068679.1.11006 WP_000068679.1.11032 WP_000068679.1.11047 WP_000068679.1.11068 WP_000068679.1.11071 WP_000068679.1.11091 WP_000068679.1.1111 WP_000068679.1.11118 WP_000068679.1.11121 WP_000068679.1.1113 WP_000068679.1.11133 WP_000068679.1.112 WP_000068679.1.1122 WP_000068679.1.11240 WP_000068679.1.11250 WP_000068679.1.11251 WP_000068679.1.11272 WP_000068679.1.11285 WP_000068679.1.11296 WP_000068679.1.11301 WP_000068679.1.11323 WP_000068679.1.11408 WP_000068679.1.11411 WP_000068679.1.11418 WP_000068679.1.11420 WP_000068679.1.11436 WP_000068679.1.11437 WP_000068679.1.11440 WP_000068679.1.11452 WP_000068679.1.11499 WP_000068679.1.11524 WP_000068679.1.11531 WP_000068679.1.11578 WP_000068679.1.11595 WP_000068679.1.11612 WP_000068679.1.11616 WP_000068679.1.11645 WP_000068679.1.11671 WP_000068679.1.11673 WP_000068679.1.11690 WP_000068679.1.11699 WP_000068679.1.11748 WP_000068679.1.11759 WP_000068679.1.1176 WP_000068679.1.11762 WP_000068679.1.11801 WP_000068679.1.11803 WP_000068679.1.11844 WP_000068679.1.1186 WP_000068679.1.11912 WP_000068679.1.11949 WP_000068679.1.11955 WP_000068679.1.11982 WP_000068679.1.11985 WP_000068679.1.12000 WP_000068679.1.12030 WP_000068679.1.12036 WP_000068679.1.12051 WP_000068679.1.12060 WP_000068679.1.12076 WP_000068679.1.12095 WP_000068679.1.12112 WP_000068679.1.1212 WP_000068679.1.1218 WP_000068679.1.12204 WP_000068679.1.12259 WP_000068679.1.12279 WP_000068679.1.12292 WP_000068679.1.12305 WP_000068679.1.12319 WP_000068679.1.12320 WP_000068679.1.12342 WP_000068679.1.12344 WP_000068679.1.12415 WP_000068679.1.1242 WP_000068679.1.12426 WP_000068679.1.12458 WP_000068679.1.12468 WP_000068679.1.12478 WP_000068679.1.12542 WP_000068679.1.12552 WP_000068679.1.12558 WP_000068679.1.12566 WP_000068679.1.12582 WP_000068679.1.12594 WP_000068679.1.12623 WP_000068679.1.12645 WP_000068679.1.12675 WP_000068679.1.12680 WP_000068679.1.12693 WP_000068679.1.127 WP_000068679.1.12717 WP_000068679.1.12743 WP_000068679.1.12749 WP_000068679.1.1275 WP_000068679.1.12756 WP_000068679.1.12761 WP_000068679.1.12762 WP_000068679.1.12775 WP_000068679.1.12781 WP_000068679.1.1280 WP_000068679.1.12826 WP_000068679.1.12831 WP_000068679.1.12876 WP_000068679.1.12911 WP_000068679.1.1295 WP_000068679.1.12965 WP_000068679.1.12979 WP_000068679.1.12987 WP_000068679.1.13002 WP_000068679.1.13015 WP_000068679.1.13031 WP_000068679.1.13060 WP_000068679.1.13074 WP_000068679.1.1312 WP_000068679.1.13136 WP_000068679.1.13144 WP_000068679.1.1315 WP_000068679.1.13157 WP_000068679.1.13162 WP_000068679.1.13176 WP_000068679.1.13217 WP_000068679.1.13222 WP_000068679.1.13223 WP_000068679.1.1323 WP_000068679.1.13239 WP_000068679.1.13252 WP_000068679.1.13258 WP_000068679.1.13290 WP_000068679.1.13301 WP_000068679.1.13332 WP_000068679.1.13333 WP_000068679.1.13346 WP_000068679.1.13348 WP_000068679.1.1335 WP_000068679.1.13383 WP_000068679.1.13409 WP_000068679.1.13411 WP_000068679.1.13430 WP_000068679.1.13437 WP_000068679.1.13442 WP_000068679.1.1345 WP_000068679.1.13451 WP_000068679.1.13481 WP_000068679.1.13492 WP_000068679.1.13495 WP_000068679.1.13525 WP_000068679.1.13566 WP_000068679.1.13585 WP_000068679.1.13589 WP_000068679.1.13601 WP_000068679.1.13608 WP_000068679.1.13618 WP_000068679.1.13624 WP_000068679.1.13664 WP_000068679.1.13672 WP_000068679.1.13740 WP_000068679.1.13791 WP_000068679.1.13798 WP_000068679.1.13824 WP_000068679.1.13867 WP_000068679.1.13877 WP_000068679.1.13881 WP_000068679.1.13891 WP_000068679.1.13924 WP_000068679.1.13936 WP_000068679.1.13939 WP_000068679.1.13944 WP_000068679.1.13949 WP_000068679.1.13981 WP_000068679.1.14030 WP_000068679.1.14058 WP_000068679.1.14062 WP_000068679.1.14070 WP_000068679.1.14094 WP_000068679.1.14110 WP_000068679.1.14127 WP_000068679.1.14129 WP_000068679.1.14154 WP_000068679.1.1419 WP_000068679.1.142 WP_000068679.1.14245 WP_000068679.1.14253 WP_000068679.1.14277 WP_000068679.1.14292 WP_000068679.1.14299 WP_000068679.1.14304 WP_000068679.1.14346 WP_000068679.1.1438 WP_000068679.1.1439 WP_000068679.1.14398 WP_000068679.1.14417 WP_000068679.1.14432 WP_000068679.1.14451 WP_000068679.1.14453 WP_000068679.1.14468 WP_000068679.1.14493 WP_000068679.1.14499 WP_000068679.1.14501 WP_000068679.1.14508 WP_000068679.1.14509 WP_000068679.1.14529 WP_000068679.1.14536 WP_000068679.1.14582 WP_000068679.1.14600 WP_000068679.1.14601 WP_000068679.1.1461 WP_000068679.1.14621 WP_000068679.1.14648 WP_000068679.1.14672 WP_000068679.1.14678 WP_000068679.1.14687 WP_000068679.1.14693 WP_000068679.1.1470 WP_000068679.1.14711 WP_000068679.1.14748 WP_000068679.1.14811 WP_000068679.1.1486 WP_000068679.1.14861 WP_000068679.1.14871 WP_000068679.1.14879 WP_000068679.1.14956 WP_000068679.1.14958 WP_000068679.1.14965 WP_000068679.1.14977 WP_000068679.1.14992 WP_000068679.1.14993 WP_000068679.1.15007 WP_000068679.1.15041 WP_000068679.1.1508 WP_000068679.1.15087 WP_000068679.1.1510 WP_000068679.1.1512 WP_000068679.1.15121 WP_000068679.1.15138 WP_000068679.1.15148 WP_000068679.1.15177 WP_000068679.1.15191 WP_000068679.1.15193 WP_000068679.1.15207 WP_000068679.1.15221 WP_000068679.1.1524 WP_000068679.1.15245 WP_000068679.1.15252 WP_000068679.1.15259 WP_000068679.1.15270 WP_000068679.1.15277 WP_000068679.1.15282 WP_000068679.1.153 WP_000068679.1.15300 WP_000068679.1.15332 WP_000068679.1.15335 WP_000068679.1.15356 WP_000068679.1.15377 WP_000068679.1.15416 WP_000068679.1.1543 WP_000068679.1.15444 WP_000068679.1.15464 WP_000068679.1.15469 WP_000068679.1.15496 WP_000068679.1.1550 WP_000068679.1.15503 WP_000068679.1.15521 WP_000068679.1.15527 WP_000068679.1.15528 WP_000068679.1.15538 WP_000068679.1.15565 WP_000068679.1.15576 WP_000068679.1.15583 WP_000068679.1.1559 WP_000068679.1.15593 WP_000068679.1.15600 WP_000068679.1.1561 WP_000068679.1.15620 WP_000068679.1.15626 WP_000068679.1.15645 WP_000068679.1.15654 WP_000068679.1.15702 WP_000068679.1.15707 WP_000068679.1.15731 WP_000068679.1.15740 WP_000068679.1.15747 WP_000068679.1.15752 WP_000068679.1.15762 WP_000068679.1.15767 WP_000068679.1.15768 WP_000068679.1.15771 WP_000068679.1.15782 WP_000068679.1.15791 WP_000068679.1.1580 WP_000068679.1.15809 WP_000068679.1.1582 WP_000068679.1.15857 WP_000068679.1.1588 WP_000068679.1.15894 WP_000068679.1.15916 WP_000068679.1.15945 WP_000068679.1.15983 WP_000068679.1.16014 WP_000068679.1.16015 WP_000068679.1.16042 WP_000068679.1.16075 WP_000068679.1.16086 WP_000068679.1.16087 WP_000068679.1.1609 WP_000068679.1.16102 WP_000068679.1.16111 WP_000068679.1.16133 WP_000068679.1.16154 WP_000068679.1.16171 WP_000068679.1.16179 WP_000068679.1.16183 WP_000068679.1.16188 WP_000068679.1.16194 WP_000068679.1.1621 WP_000068679.1.16222 WP_000068679.1.16272 WP_000068679.1.16294 WP_000068679.1.163 WP_000068679.1.16303 WP_000068679.1.1634 WP_000068679.1.16387 WP_000068679.1.16388 WP_000068679.1.1640 WP_000068679.1.16435 WP_000068679.1.16463 WP_000068679.1.16481 WP_000068679.1.16482 WP_000068679.1.16500 WP_000068679.1.16517 WP_000068679.1.16532 WP_000068679.1.16539 WP_000068679.1.16541 WP_000068679.1.1655 WP_000068679.1.16577 WP_000068679.1.16592 WP_000068679.1.16604 WP_000068679.1.16612 WP_000068679.1.16640 WP_000068679.1.16648 WP_000068679.1.16669 WP_000068679.1.16682 WP_000068679.1.16700 WP_000068679.1.16715 WP_000068679.1.16721 WP_000068679.1.1673 WP_000068679.1.16745 WP_000068679.1.16752 WP_000068679.1.16805 WP_000068679.1.16845 WP_000068679.1.16861 WP_000068679.1.16862 WP_000068679.1.16894 WP_000068679.1.16970 WP_000068679.1.16992 WP_000068679.1.17017 WP_000068679.1.17018 WP_000068679.1.17042 WP_000068679.1.17084 WP_000068679.1.17085 WP_000068679.1.17087 WP_000068679.1.17089 WP_000068679.1.1710 WP_000068679.1.17101 WP_000068679.1.17102 WP_000068679.1.17109 WP_000068679.1.17111 WP_000068679.1.17114 WP_000068679.1.17119 WP_000068679.1.17123 WP_000068679.1.17150 WP_000068679.1.17153 WP_000068679.1.17170 WP_000068679.1.17172 WP_000068679.1.17182 WP_000068679.1.17186 WP_000068679.1.17187 WP_000068679.1.17205 WP_000068679.1.17216 WP_000068679.1.17230 WP_000068679.1.17241 WP_000068679.1.17242 WP_000068679.1.1726 WP_000068679.1.17267 WP_000068679.1.17282 WP_000068679.1.17290 WP_000068679.1.17297 WP_000068679.1.17300 WP_000068679.1.17301 WP_000068679.1.1731 WP_000068679.1.17356 WP_000068679.1.17360 WP_000068679.1.17373 WP_000068679.1.17386 WP_000068679.1.17389 WP_000068679.1.17392 WP_000068679.1.17403 WP_000068679.1.17410 WP_000068679.1.17415 WP_000068679.1.17417 WP_000068679.1.17432 WP_000068679.1.17441 WP_000068679.1.17464 WP_000068679.1.17515 WP_000068679.1.17534 WP_000068679.1.1754 WP_000068679.1.1755 WP_000068679.1.17550 WP_000068679.1.17570 WP_000068679.1.17577 WP_000068679.1.17595 WP_000068679.1.17623 WP_000068679.1.1763 WP_000068679.1.17637 WP_000068679.1.1766 WP_000068679.1.17680 WP_000068679.1.1769 WP_000068679.1.17701 WP_000068679.1.17711 WP_000068679.1.17734 WP_000068679.1.17765 WP_000068679.1.17766 WP_000068679.1.1778 WP_000068679.1.17802 WP_000068679.1.17829 WP_000068679.1.17831 WP_000068679.1.17836 WP_000068679.1.17889 WP_000068679.1.17904 WP_000068679.1.17920 WP_000068679.1.17937 WP_000068679.1.17952 WP_000068679.1.17961 WP_000068679.1.17963 WP_000068679.1.17984 WP_000068679.1.18000 WP_000068679.1.18006 WP_000068679.1.1802 WP_000068679.1.18050 WP_000068679.1.18064 WP_000068679.1.18094 WP_000068679.1.18112 WP_000068679.1.18133 WP_000068679.1.18134 WP_000068679.1.18136 WP_000068679.1.18141 WP_000068679.1.18164 WP_000068679.1.18175 WP_000068679.1.18225 WP_000068679.1.18226 WP_000068679.1.18229 WP_000068679.1.18311 WP_000068679.1.18326 WP_000068679.1.18329 WP_000068679.1.18338 WP_000068679.1.1834 WP_000068679.1.18340 WP_000068679.1.18354 WP_000068679.1.18381 WP_000068679.1.18402 WP_000068679.1.18410 WP_000068679.1.18436 WP_000068679.1.18438 WP_000068679.1.1844 WP_000068679.1.18458 WP_000068679.1.18482 WP_000068679.1.18511 WP_000068679.1.18519 WP_000068679.1.18530 WP_000068679.1.18550 WP_000068679.1.18583 WP_000068679.1.18588 WP_000068679.1.18628 WP_000068679.1.18649 WP_000068679.1.18650 WP_000068679.1.1866 WP_000068679.1.18666 WP_000068679.1.1867 WP_000068679.1.18675 WP_000068679.1.18699 WP_000068679.1.18714 WP_000068679.1.18726 WP_000068679.1.188 WP_000068679.1.18806 WP_000068679.1.1881 WP_000068679.1.18837 WP_000068679.1.18858 WP_000068679.1.18861 WP_000068679.1.18874 WP_000068679.1.18876 WP_000068679.1.18899 WP_000068679.1.18923 WP_000068679.1.18929 WP_000068679.1.18936 WP_000068679.1.18966 WP_000068679.1.18995 WP_000068679.1.19024 WP_000068679.1.1903 WP_000068679.1.19036 WP_000068679.1.19039 WP_000068679.1.19075 WP_000068679.1.1909 WP_000068679.1.19090 WP_000068679.1.191 WP_000068679.1.19100 WP_000068679.1.19113 WP_000068679.1.19114 WP_000068679.1.19122 WP_000068679.1.19129 WP_000068679.1.19140 WP_000068679.1.19147 WP_000068679.1.19148 WP_000068679.1.1915 WP_000068679.1.19150 WP_000068679.1.19194 WP_000068679.1.19205 WP_000068679.1.19206 WP_000068679.1.1925 WP_000068679.1.19297 WP_000068679.1.193 WP_000068679.1.19312 WP_000068679.1.19313 WP_000068679.1.19314 WP_000068679.1.19315 WP_000068679.1.19332 WP_000068679.1.19338 WP_000068679.1.19347 WP_000068679.1.19350 WP_000068679.1.19361 WP_000068679.1.19389 WP_000068679.1.19397 WP_000068679.1.19419 WP_000068679.1.19424 WP_000068679.1.19441 WP_000068679.1.19448 WP_000068679.1.19453 WP_000068679.1.19478 WP_000068679.1.19487 WP_000068679.1.19494 WP_000068679.1.19544 WP_000068679.1.19557 WP_000068679.1.19581 WP_000068679.1.19583 WP_000068679.1.19602 WP_000068679.1.1963 WP_000068679.1.19644 WP_000068679.1.19651 WP_000068679.1.19655 WP_000068679.1.19661 WP_000068679.1.19684 WP_000068679.1.19691 WP_000068679.1.19758 WP_000068679.1.19778 WP_000068679.1.19795 WP_000068679.1.1982 WP_000068679.1.19838 WP_000068679.1.19840 WP_000068679.1.19845 WP_000068679.1.19847 WP_000068679.1.1987 WP_000068679.1.19873 WP_000068679.1.19878 WP_000068679.1.19889 WP_000068679.1.19940 WP_000068679.1.19945 WP_000068679.1.19957 WP_000068679.1.20025 WP_000068679.1.2005 WP_000068679.1.20096 WP_000068679.1.20114 WP_000068679.1.20129 WP_000068679.1.20133 WP_000068679.1.20136 WP_000068679.1.2015 WP_000068679.1.20157 WP_000068679.1.20159 WP_000068679.1.20164 WP_000068679.1.20166 WP_000068679.1.20170 WP_000068679.1.20178 WP_000068679.1.20183 WP_000068679.1.20192 WP_000068679.1.20215 WP_000068679.1.2022 WP_000068679.1.20230 WP_000068679.1.20251 WP_000068679.1.20264 WP_000068679.1.2027 WP_000068679.1.20277 WP_000068679.1.20290 WP_000068679.1.20308 WP_000068679.1.20318 WP_000068679.1.20325 WP_000068679.1.20331 WP_000068679.1.20334 WP_000068679.1.20370 WP_000068679.1.20445 WP_000068679.1.20449 WP_000068679.1.20480 WP_000068679.1.20483 WP_000068679.1.20484 WP_000068679.1.20506 WP_000068679.1.20515 WP_000068679.1.20519 WP_000068679.1.20536 WP_000068679.1.20546 WP_000068679.1.20549 WP_000068679.1.20594 WP_000068679.1.20596 WP_000068679.1.2063 WP_000068679.1.20630 WP_000068679.1.20636 WP_000068679.1.20638 WP_000068679.1.20662 WP_000068679.1.20668 WP_000068679.1.20691 WP_000068679.1.20709 WP_000068679.1.20724 WP_000068679.1.20730 WP_000068679.1.20737 WP_000068679.1.20745 WP_000068679.1.20761 WP_000068679.1.20765 WP_000068679.1.20785 WP_000068679.1.20813 WP_000068679.1.20824 WP_000068679.1.20831 WP_000068679.1.20848 WP_000068679.1.20893 WP_000068679.1.20907 WP_000068679.1.2093 WP_000068679.1.2094 WP_000068679.1.20941 WP_000068679.1.20943 WP_000068679.1.20950 WP_000068679.1.20958 WP_000068679.1.20982 WP_000068679.1.20989 WP_000068679.1.2100 WP_000068679.1.21017 WP_000068679.1.21020 WP_000068679.1.21022 WP_000068679.1.21024 WP_000068679.1.21029 WP_000068679.1.21033 WP_000068679.1.21041 WP_000068679.1.21057 WP_000068679.1.21059 WP_000068679.1.21104 WP_000068679.1.21122 WP_000068679.1.21129 WP_000068679.1.2113 WP_000068679.1.21131 WP_000068679.1.21137 WP_000068679.1.21171 WP_000068679.1.21197 WP_000068679.1.21248 WP_000068679.1.21251 WP_000068679.1.21277 WP_000068679.1.21305 WP_000068679.1.21320 WP_000068679.1.21336 WP_000068679.1.21441 WP_000068679.1.21470 WP_000068679.1.21508 WP_000068679.1.21519 WP_000068679.1.2156 WP_000068679.1.21573 WP_000068679.1.21578 WP_000068679.1.21596 WP_000068679.1.21628 WP_000068679.1.21637 WP_000068679.1.2164 WP_000068679.1.21656 WP_000068679.1.21666 WP_000068679.1.21667 WP_000068679.1.21668 WP_000068679.1.21673 WP_000068679.1.21696 WP_000068679.1.21714 WP_000068679.1.21727 WP_000068679.1.21732 WP_000068679.1.21733 WP_000068679.1.21756 WP_000068679.1.21758 WP_000068679.1.21762 WP_000068679.1.21771 WP_000068679.1.21811 WP_000068679.1.21812 WP_000068679.1.21823 WP_000068679.1.21887 WP_000068679.1.21895 WP_000068679.1.21915 WP_000068679.1.21945 WP_000068679.1.21948 WP_000068679.1.21962 WP_000068679.1.21986 WP_000068679.1.21992 WP_000068679.1.22060 WP_000068679.1.22113 WP_000068679.1.22138 WP_000068679.1.2218 WP_000068679.1.22195 WP_000068679.1.22204 WP_000068679.1.22251 WP_000068679.1.22268 WP_000068679.1.22269 WP_000068679.1.22291 WP_000068679.1.22293 WP_000068679.1.22295 WP_000068679.1.22304 WP_000068679.1.22314 WP_000068679.1.2232 WP_000068679.1.22325 WP_000068679.1.22328 WP_000068679.1.22350 WP_000068679.1.22359 WP_000068679.1.22363 WP_000068679.1.22381 WP_000068679.1.22409 WP_000068679.1.22470 WP_000068679.1.22494 WP_000068679.1.22501 WP_000068679.1.22522 WP_000068679.1.22544 WP_000068679.1.22571 WP_000068679.1.22579 WP_000068679.1.22594 WP_000068679.1.22599 WP_000068679.1.22631 WP_000068679.1.22632 WP_000068679.1.22641 WP_000068679.1.22649 WP_000068679.1.22662 WP_000068679.1.22669 WP_000068679.1.22685 WP_000068679.1.22690 WP_000068679.1.22743 WP_000068679.1.22756 WP_000068679.1.22757 WP_000068679.1.22759 WP_000068679.1.22765 WP_000068679.1.22771 WP_000068679.1.22777 WP_000068679.1.22783 WP_000068679.1.22809 WP_000068679.1.22827 WP_000068679.1.22830 WP_000068679.1.22846 WP_000068679.1.22868 WP_000068679.1.22875 WP_000068679.1.22878 WP_000068679.1.22885 WP_000068679.1.22896 WP_000068679.1.22908 WP_000068679.1.22925 WP_000068679.1.22961 WP_000068679.1.22988 WP_000068679.1.22990 WP_000068679.1.2300 WP_000068679.1.23005 WP_000068679.1.23026 WP_000068679.1.23035 WP_000068679.1.23042 WP_000068679.1.23044 WP_000068679.1.23045 WP_000068679.1.23057 WP_000068679.1.23062 WP_000068679.1.23073 WP_000068679.1.23078 WP_000068679.1.23081 WP_000068679.1.23090 WP_000068679.1.23092 WP_000068679.1.23105 WP_000068679.1.23115 WP_000068679.1.23120 WP_000068679.1.23135 WP_000068679.1.23241 WP_000068679.1.2325 WP_000068679.1.23257 WP_000068679.1.23270 WP_000068679.1.23285 WP_000068679.1.23290 WP_000068679.1.23293 WP_000068679.1.23299 WP_000068679.1.23323 WP_000068679.1.23352 WP_000068679.1.23355 WP_000068679.1.23376 WP_000068679.1.23378 WP_000068679.1.23383 WP_000068679.1.23388 WP_000068679.1.23393 WP_000068679.1.23443 WP_000068679.1.23456 WP_000068679.1.23463 WP_000068679.1.23467 WP_000068679.1.23486 WP_000068679.1.23487 WP_000068679.1.23511 WP_000068679.1.23520 WP_000068679.1.23527 WP_000068679.1.2353 WP_000068679.1.23549 WP_000068679.1.23554 WP_000068679.1.23561 WP_000068679.1.23563 WP_000068679.1.23584 WP_000068679.1.23593 WP_000068679.1.2362 WP_000068679.1.23622 WP_000068679.1.23640 WP_000068679.1.23660 WP_000068679.1.23676 WP_000068679.1.23693 WP_000068679.1.23729 WP_000068679.1.23741 WP_000068679.1.23754 WP_000068679.1.23765 WP_000068679.1.23790 WP_000068679.1.23795 WP_000068679.1.23806 WP_000068679.1.23812 WP_000068679.1.23838 WP_000068679.1.2388 WP_000068679.1.23881 WP_000068679.1.23886 WP_000068679.1.23895 WP_000068679.1.23899 WP_000068679.1.23914 WP_000068679.1.23915 WP_000068679.1.23931 WP_000068679.1.23945 WP_000068679.1.2395 WP_000068679.1.23950 WP_000068679.1.23962 WP_000068679.1.23970 WP_000068679.1.23971 WP_000068679.1.23973 WP_000068679.1.23984 WP_000068679.1.24 WP_000068679.1.24024 WP_000068679.1.24045 WP_000068679.1.24051 WP_000068679.1.24058 WP_000068679.1.24068 WP_000068679.1.24070 WP_000068679.1.24088 WP_000068679.1.24089 WP_000068679.1.24120 WP_000068679.1.24122 WP_000068679.1.24124 WP_000068679.1.24127 WP_000068679.1.24136 WP_000068679.1.24194 WP_000068679.1.24233 WP_000068679.1.24278 WP_000068679.1.2428 WP_000068679.1.24283 WP_000068679.1.24290 WP_000068679.1.2430 WP_000068679.1.24304 WP_000068679.1.24316 WP_000068679.1.2433 WP_000068679.1.24341 WP_000068679.1.24362 WP_000068679.1.2437 WP_000068679.1.24374 WP_000068679.1.24381 WP_000068679.1.24383 WP_000068679.1.24460 WP_000068679.1.24473 WP_000068679.1.24483 WP_000068679.1.24485 WP_000068679.1.24499 WP_000068679.1.24533 WP_000068679.1.24536 WP_000068679.1.24547 WP_000068679.1.2456 WP_000068679.1.24560 WP_000068679.1.24570 WP_000068679.1.24575 WP_000068679.1.24577 WP_000068679.1.24634 WP_000068679.1.24641 WP_000068679.1.24642 WP_000068679.1.24646 WP_000068679.1.24650 WP_000068679.1.24693 WP_000068679.1.24695 WP_000068679.1.24753 WP_000068679.1.24783 WP_000068679.1.2479 WP_000068679.1.24791 WP_000068679.1.24799 WP_000068679.1.24849 WP_000068679.1.24854 WP_000068679.1.24870 WP_000068679.1.24876 WP_000068679.1.24899 WP_000068679.1.24929 WP_000068679.1.24939 WP_000068679.1.24946 WP_000068679.1.24960 WP_000068679.1.24981 WP_000068679.1.24982 WP_000068679.1.24984 WP_000068679.1.25019 WP_000068679.1.25021 WP_000068679.1.25038 WP_000068679.1.25039 WP_000068679.1.2504 WP_000068679.1.25042 WP_000068679.1.25050 WP_000068679.1.25060 WP_000068679.1.25076 WP_000068679.1.25082 WP_000068679.1.25085 WP_000068679.1.25086 WP_000068679.1.25087 WP_000068679.1.25088 WP_000068679.1.25126 WP_000068679.1.25141 WP_000068679.1.25183 WP_000068679.1.25201 WP_000068679.1.25203 WP_000068679.1.25204 WP_000068679.1.25289 WP_000068679.1.25305 WP_000068679.1.2531 WP_000068679.1.25312 WP_000068679.1.25324 WP_000068679.1.25346 WP_000068679.1.2537 WP_000068679.1.25378 WP_000068679.1.254 WP_000068679.1.25403 WP_000068679.1.25414 WP_000068679.1.2543 WP_000068679.1.255 WP_000068679.1.25517 WP_000068679.1.25525 WP_000068679.1.25526 WP_000068679.1.25548 WP_000068679.1.25577 WP_000068679.1.2558 WP_000068679.1.25592 WP_000068679.1.25598 WP_000068679.1.25602 WP_000068679.1.25613 WP_000068679.1.25631 WP_000068679.1.25652 WP_000068679.1.25713 WP_000068679.1.25717 WP_000068679.1.25718 WP_000068679.1.25753 WP_000068679.1.25755 WP_000068679.1.25794 WP_000068679.1.25799 WP_000068679.1.25819 WP_000068679.1.25831 WP_000068679.1.25832 WP_000068679.1.25843 WP_000068679.1.25855 WP_000068679.1.25869 WP_000068679.1.25886 WP_000068679.1.2589 WP_000068679.1.25915 WP_000068679.1.25945 WP_000068679.1.25996 WP_000068679.1.26005 WP_000068679.1.26048 WP_000068679.1.26055 WP_000068679.1.26066 WP_000068679.1.26100 WP_000068679.1.26105 WP_000068679.1.2612 WP_000068679.1.26121 WP_000068679.1.26125 WP_000068679.1.26130 WP_000068679.1.26134 WP_000068679.1.26135 WP_000068679.1.26150 WP_000068679.1.26161 WP_000068679.1.26186 WP_000068679.1.26191 WP_000068679.1.26246 WP_000068679.1.26264 WP_000068679.1.26270 WP_000068679.1.26331 WP_000068679.1.2637 WP_000068679.1.26379 WP_000068679.1.26391 WP_000068679.1.26401 WP_000068679.1.26403 WP_000068679.1.2642 WP_000068679.1.26438 WP_000068679.1.26443 WP_000068679.1.26467 WP_000068679.1.26474 WP_000068679.1.26479 WP_000068679.1.26480 WP_000068679.1.26517 WP_000068679.1.26525 WP_000068679.1.26569 WP_000068679.1.26570 WP_000068679.1.26575 WP_000068679.1.26588 WP_000068679.1.26590 WP_000068679.1.26598 WP_000068679.1.26609 WP_000068679.1.26613 WP_000068679.1.26627 WP_000068679.1.26644 WP_000068679.1.26658 WP_000068679.1.26683 WP_000068679.1.26716 WP_000068679.1.26720 WP_000068679.1.26736 WP_000068679.1.26761 WP_000068679.1.26766 WP_000068679.1.26878 WP_000068679.1.26912 WP_000068679.1.2694 WP_000068679.1.26941 WP_000068679.1.26943 WP_000068679.1.26975 WP_000068679.1.26998 WP_000068679.1.27019 WP_000068679.1.27057 WP_000068679.1.27060 WP_000068679.1.27098 WP_000068679.1.27101 WP_000068679.1.27105 WP_000068679.1.2712 WP_000068679.1.27134 WP_000068679.1.27141 WP_000068679.1.27148 WP_000068679.1.27175 WP_000068679.1.27188 WP_000068679.1.27214 WP_000068679.1.27234 WP_000068679.1.27260 WP_000068679.1.27280 WP_000068679.1.27283 WP_000068679.1.27292 WP_000068679.1.2731 WP_000068679.1.27310 WP_000068679.1.27330 WP_000068679.1.27338 WP_000068679.1.27367 WP_000068679.1.27373 WP_000068679.1.27424 WP_000068679.1.27426 WP_000068679.1.27445 WP_000068679.1.27451 WP_000068679.1.27472 WP_000068679.1.27504 WP_000068679.1.27518 WP_000068679.1.27524 WP_000068679.1.2755 WP_000068679.1.27560 WP_000068679.1.27580 WP_000068679.1.27611 WP_000068679.1.27683 WP_000068679.1.27691 WP_000068679.1.27698 WP_000068679.1.27723 WP_000068679.1.27734 WP_000068679.1.27741 WP_000068679.1.27742 WP_000068679.1.27749 WP_000068679.1.27758 WP_000068679.1.27774 WP_000068679.1.27786 WP_000068679.1.27856 WP_000068679.1.27871 WP_000068679.1.27879 WP_000068679.1.27897 WP_000068679.1.27923 WP_000068679.1.27932 WP_000068679.1.2794 WP_000068679.1.27957 WP_000068679.1.27971 WP_000068679.1.28046 WP_000068679.1.28051 WP_000068679.1.28109 WP_000068679.1.2811 WP_000068679.1.28110 WP_000068679.1.28128 WP_000068679.1.28143 WP_000068679.1.28168 WP_000068679.1.2823 WP_000068679.1.28250 WP_000068679.1.2826 WP_000068679.1.28268 WP_000068679.1.28271 WP_000068679.1.28305 WP_000068679.1.28371 WP_000068679.1.28401 WP_000068679.1.28414 WP_000068679.1.28433 WP_000068679.1.28440 WP_000068679.1.28480 WP_000068679.1.28491 WP_000068679.1.28496 WP_000068679.1.285 WP_000068679.1.28509 WP_000068679.1.28523 WP_000068679.1.28536 WP_000068679.1.28540 WP_000068679.1.28544 WP_000068679.1.28551 WP_000068679.1.28662 WP_000068679.1.28683 WP_000068679.1.28697 WP_000068679.1.28711 WP_000068679.1.28734 WP_000068679.1.28760 WP_000068679.1.28762 WP_000068679.1.28769 WP_000068679.1.28791 WP_000068679.1.28809 WP_000068679.1.2881 WP_000068679.1.28835 WP_000068679.1.28863 WP_000068679.1.28879 WP_000068679.1.28919 WP_000068679.1.28950 WP_000068679.1.28953 WP_000068679.1.28982 WP_000068679.1.28994 WP_000068679.1.290 WP_000068679.1.29001 WP_000068679.1.29013 WP_000068679.1.29016 WP_000068679.1.29026 WP_000068679.1.29055 WP_000068679.1.29061 WP_000068679.1.29079 WP_000068679.1.29082 WP_000068679.1.291 WP_000068679.1.29100 WP_000068679.1.29125 WP_000068679.1.29126 WP_000068679.1.29128 WP_000068679.1.29146 WP_000068679.1.29150 WP_000068679.1.29176 WP_000068679.1.29194 WP_000068679.1.29197 WP_000068679.1.29206 WP_000068679.1.29221 WP_000068679.1.29230 WP_000068679.1.29252 WP_000068679.1.2926 WP_000068679.1.2931 WP_000068679.1.29404 WP_000068679.1.2942 WP_000068679.1.29429 WP_000068679.1.2945 WP_000068679.1.29495 WP_000068679.1.29503 WP_000068679.1.29504 WP_000068679.1.2954 WP_000068679.1.29556 WP_000068679.1.29564 WP_000068679.1.29590 WP_000068679.1.29597 WP_000068679.1.29603 WP_000068679.1.29618 WP_000068679.1.29643 WP_000068679.1.29669 WP_000068679.1.29683 WP_000068679.1.29689 WP_000068679.1.29699 WP_000068679.1.29715 WP_000068679.1.29724 WP_000068679.1.29740 WP_000068679.1.29746 WP_000068679.1.29752 WP_000068679.1.2978 WP_000068679.1.29798 WP_000068679.1.29812 WP_000068679.1.29818 WP_000068679.1.29821 WP_000068679.1.29840 WP_000068679.1.2986 WP_000068679.1.29874 WP_000068679.1.29876 WP_000068679.1.29933 WP_000068679.1.2995 WP_000068679.1.29976 WP_000068679.1.29992 WP_000068679.1.30 WP_000068679.1.30004 WP_000068679.1.30016 WP_000068679.1.30019 WP_000068679.1.30035 WP_000068679.1.30052 WP_000068679.1.30064 WP_000068679.1.30098 WP_000068679.1.30105 WP_000068679.1.30123 WP_000068679.1.30141 WP_000068679.1.30164 WP_000068679.1.30221 WP_000068679.1.30231 WP_000068679.1.30247 WP_000068679.1.30253 WP_000068679.1.30347 WP_000068679.1.30397 WP_000068679.1.30399 WP_000068679.1.30401 WP_000068679.1.30428 WP_000068679.1.3045 WP_000068679.1.30452 WP_000068679.1.30472 WP_000068679.1.30476 WP_000068679.1.30479 WP_000068679.1.30497 WP_000068679.1.30546 WP_000068679.1.30554 WP_000068679.1.30570 WP_000068679.1.30580 WP_000068679.1.3063 WP_000068679.1.30630 WP_000068679.1.30637 WP_000068679.1.30639 WP_000068679.1.30640 WP_000068679.1.30700 WP_000068679.1.30733 WP_000068679.1.30742 WP_000068679.1.30749 WP_000068679.1.30783 WP_000068679.1.30843 WP_000068679.1.30853 WP_000068679.1.30866 WP_000068679.1.309 WP_000068679.1.30905 WP_000068679.1.30906 WP_000068679.1.30918 WP_000068679.1.30960 WP_000068679.1.30993 WP_000068679.1.30999 WP_000068679.1.31000 WP_000068679.1.31009 WP_000068679.1.31026 WP_000068679.1.31055 WP_000068679.1.31089 WP_000068679.1.31142 WP_000068679.1.31154 WP_000068679.1.312 WP_000068679.1.31211 WP_000068679.1.31252 WP_000068679.1.31295 WP_000068679.1.31319 WP_000068679.1.31340 WP_000068679.1.31347 WP_000068679.1.31353 WP_000068679.1.31357 WP_000068679.1.31379 WP_000068679.1.3140 WP_000068679.1.31401 WP_000068679.1.31407 WP_000068679.1.31419 WP_000068679.1.31421 WP_000068679.1.31429 WP_000068679.1.31431 WP_000068679.1.31434 WP_000068679.1.31482 WP_000068679.1.31506 WP_000068679.1.31518 WP_000068679.1.31521 WP_000068679.1.31527 WP_000068679.1.31559 WP_000068679.1.31575 WP_000068679.1.31614 WP_000068679.1.31618 WP_000068679.1.31625 WP_000068679.1.31639 WP_000068679.1.31679 WP_000068679.1.31681 WP_000068679.1.3169 WP_000068679.1.31696 WP_000068679.1.31709 WP_000068679.1.31715 WP_000068679.1.31736 WP_000068679.1.31740 WP_000068679.1.3176 WP_000068679.1.31801 WP_000068679.1.31803 WP_000068679.1.31833 WP_000068679.1.31835 WP_000068679.1.31839 WP_000068679.1.31860 WP_000068679.1.31866 WP_000068679.1.31898 WP_000068679.1.31899 WP_000068679.1.31903 WP_000068679.1.31924 WP_000068679.1.31928 WP_000068679.1.3193 WP_000068679.1.31937 WP_000068679.1.31956 WP_000068679.1.31978 WP_000068679.1.3201 WP_000068679.1.32020 WP_000068679.1.32037 WP_000068679.1.32049 WP_000068679.1.32063 WP_000068679.1.32078 WP_000068679.1.32089 WP_000068679.1.32091 WP_000068679.1.32094 WP_000068679.1.3212 WP_000068679.1.32121 WP_000068679.1.32127 WP_000068679.1.32142 WP_000068679.1.32143 WP_000068679.1.3215 WP_000068679.1.32173 WP_000068679.1.32184 WP_000068679.1.322 WP_000068679.1.32222 WP_000068679.1.32232 WP_000068679.1.32234 WP_000068679.1.32236 WP_000068679.1.32242 WP_000068679.1.32243 WP_000068679.1.32279 WP_000068679.1.32287 WP_000068679.1.32333 WP_000068679.1.32394 WP_000068679.1.32406 WP_000068679.1.32435 WP_000068679.1.32443 WP_000068679.1.32448 WP_000068679.1.3247 WP_000068679.1.32475 WP_000068679.1.32478 WP_000068679.1.32479 WP_000068679.1.3248 WP_000068679.1.32494 WP_000068679.1.32509 WP_000068679.1.32536 WP_000068679.1.32561 WP_000068679.1.32574 WP_000068679.1.32580 WP_000068679.1.32590 WP_000068679.1.32591 WP_000068679.1.32601 WP_000068679.1.32635 WP_000068679.1.32655 WP_000068679.1.32680 WP_000068679.1.327 WP_000068679.1.32709 WP_000068679.1.32715 WP_000068679.1.32720 WP_000068679.1.32722 WP_000068679.1.32724 WP_000068679.1.32741 WP_000068679.1.32811 WP_000068679.1.32815 WP_000068679.1.32831 WP_000068679.1.32835 WP_000068679.1.32875 WP_000068679.1.32888 WP_000068679.1.32903 WP_000068679.1.32910 WP_000068679.1.32931 WP_000068679.1.32946 WP_000068679.1.3295 WP_000068679.1.32959 WP_000068679.1.32972 WP_000068679.1.32984 WP_000068679.1.32992 WP_000068679.1.32995 WP_000068679.1.33004 WP_000068679.1.33014 WP_000068679.1.33018 WP_000068679.1.33022 WP_000068679.1.33049 WP_000068679.1.33053 WP_000068679.1.33055 WP_000068679.1.33094 WP_000068679.1.33119 WP_000068679.1.33125 WP_000068679.1.33146 WP_000068679.1.33167 WP_000068679.1.33171 WP_000068679.1.33178 WP_000068679.1.33217 WP_000068679.1.3323 WP_000068679.1.33237 WP_000068679.1.33238 WP_000068679.1.33244 WP_000068679.1.33268 WP_000068679.1.33325 WP_000068679.1.33341 WP_000068679.1.33362 WP_000068679.1.33385 WP_000068679.1.334 WP_000068679.1.33408 WP_000068679.1.33413 WP_000068679.1.33424 WP_000068679.1.33475 WP_000068679.1.33476 WP_000068679.1.33502 WP_000068679.1.33512 WP_000068679.1.33526 WP_000068679.1.3354 WP_000068679.1.33545 WP_000068679.1.33561 WP_000068679.1.33563 WP_000068679.1.33565 WP_000068679.1.33595 WP_000068679.1.33631 WP_000068679.1.33638 WP_000068679.1.33648 WP_000068679.1.33667 WP_000068679.1.33680 WP_000068679.1.33729 WP_000068679.1.33736 WP_000068679.1.33745 WP_000068679.1.33746 WP_000068679.1.33751 WP_000068679.1.33780 WP_000068679.1.33799 WP_000068679.1.33823 WP_000068679.1.33853 WP_000068679.1.33854 WP_000068679.1.33879 WP_000068679.1.33888 WP_000068679.1.33914 WP_000068679.1.33948 WP_000068679.1.33952 WP_000068679.1.33973 WP_000068679.1.33974 WP_000068679.1.33979 WP_000068679.1.3398 WP_000068679.1.33981 WP_000068679.1.34003 WP_000068679.1.3401 WP_000068679.1.34032 WP_000068679.1.34094 WP_000068679.1.3411 WP_000068679.1.34122 WP_000068679.1.34124 WP_000068679.1.3415 WP_000068679.1.342 WP_000068679.1.34204 WP_000068679.1.34206 WP_000068679.1.34208 WP_000068679.1.34224 WP_000068679.1.34269 WP_000068679.1.34270 WP_000068679.1.34273 WP_000068679.1.34277 WP_000068679.1.34303 WP_000068679.1.34332 WP_000068679.1.34341 WP_000068679.1.34362 WP_000068679.1.34363 WP_000068679.1.34380 WP_000068679.1.34383 WP_000068679.1.3439 WP_000068679.1.34397 WP_000068679.1.3444 WP_000068679.1.34440 WP_000068679.1.34444 WP_000068679.1.34464 WP_000068679.1.34500 WP_000068679.1.34525 WP_000068679.1.34532 WP_000068679.1.34541 WP_000068679.1.34557 WP_000068679.1.34605 WP_000068679.1.34655 WP_000068679.1.34668 WP_000068679.1.34680 WP_000068679.1.34682 WP_000068679.1.34686 WP_000068679.1.347 WP_000068679.1.34727 WP_000068679.1.34781 WP_000068679.1.34782 WP_000068679.1.34794 WP_000068679.1.34827 WP_000068679.1.34855 WP_000068679.1.34948 WP_000068679.1.34982 WP_000068679.1.34983 WP_000068679.1.34993 WP_000068679.1.35006 WP_000068679.1.35007 WP_000068679.1.35039 WP_000068679.1.35114 WP_000068679.1.3515 WP_000068679.1.35180 WP_000068679.1.35186 WP_000068679.1.35195 WP_000068679.1.35202 WP_000068679.1.3521 WP_000068679.1.35211 WP_000068679.1.35316 WP_000068679.1.35349 WP_000068679.1.35360 WP_000068679.1.35368 WP_000068679.1.35376 WP_000068679.1.3539 WP_000068679.1.35393 WP_000068679.1.35398 WP_000068679.1.35464 WP_000068679.1.35465 WP_000068679.1.35466 WP_000068679.1.35468 WP_000068679.1.3550 WP_000068679.1.35552 WP_000068679.1.35581 WP_000068679.1.3560 WP_000068679.1.35604 WP_000068679.1.35649 WP_000068679.1.35651 WP_000068679.1.35653 WP_000068679.1.35654 WP_000068679.1.35698 WP_000068679.1.35704 WP_000068679.1.35724 WP_000068679.1.35740 WP_000068679.1.35904 WP_000068679.1.35922 WP_000068679.1.35927 WP_000068679.1.35934 WP_000068679.1.35942 WP_000068679.1.35959 WP_000068679.1.3598 WP_000068679.1.35983 WP_000068679.1.36010 WP_000068679.1.36040 WP_000068679.1.36042 WP_000068679.1.36070 WP_000068679.1.36071 WP_000068679.1.36085 WP_000068679.1.36094 WP_000068679.1.36129 WP_000068679.1.36159 WP_000068679.1.36164 WP_000068679.1.36166 WP_000068679.1.36177 WP_000068679.1.36182 WP_000068679.1.3620 WP_000068679.1.36212 WP_000068679.1.36281 WP_000068679.1.36299 WP_000068679.1.36332 WP_000068679.1.36386 WP_000068679.1.36393 WP_000068679.1.36412 WP_000068679.1.36426 WP_000068679.1.36453 WP_000068679.1.36496 WP_000068679.1.36500 WP_000068679.1.36507 WP_000068679.1.36523 WP_000068679.1.36531 WP_000068679.1.36537 WP_000068679.1.36610 WP_000068679.1.36626 WP_000068679.1.36628 WP_000068679.1.36707 WP_000068679.1.3671 WP_000068679.1.36739 WP_000068679.1.36746 WP_000068679.1.36747 WP_000068679.1.36767 WP_000068679.1.36799 WP_000068679.1.36806 WP_000068679.1.36812 WP_000068679.1.36817 WP_000068679.1.36826 WP_000068679.1.36833 WP_000068679.1.36886 WP_000068679.1.36904 WP_000068679.1.36971 WP_000068679.1.36975 WP_000068679.1.37006 WP_000068679.1.37020 WP_000068679.1.37046 WP_000068679.1.37076 WP_000068679.1.37099 WP_000068679.1.37101 WP_000068679.1.37102 WP_000068679.1.37122 WP_000068679.1.37146 WP_000068679.1.37155 WP_000068679.1.37206 WP_000068679.1.37233 WP_000068679.1.37252 WP_000068679.1.37261 WP_000068679.1.3730 WP_000068679.1.37313 WP_000068679.1.37329 WP_000068679.1.37334 WP_000068679.1.37337 WP_000068679.1.37352 WP_000068679.1.37371 WP_000068679.1.37372 WP_000068679.1.37419 WP_000068679.1.37433 WP_000068679.1.37445 WP_000068679.1.37472 WP_000068679.1.37476 WP_000068679.1.37485 WP_000068679.1.3749 WP_000068679.1.37510 WP_000068679.1.37538 WP_000068679.1.37543 WP_000068679.1.37549 WP_000068679.1.37554 WP_000068679.1.37576 WP_000068679.1.37588 WP_000068679.1.3762 WP_000068679.1.37634 WP_000068679.1.37637 WP_000068679.1.377 WP_000068679.1.3772 WP_000068679.1.37730 WP_000068679.1.37731 WP_000068679.1.37736 WP_000068679.1.37745 WP_000068679.1.37750 WP_000068679.1.37758 WP_000068679.1.37762 WP_000068679.1.37766 WP_000068679.1.37769 WP_000068679.1.37773 WP_000068679.1.37830 WP_000068679.1.37847 WP_000068679.1.37852 WP_000068679.1.3788 WP_000068679.1.37880 WP_000068679.1.37887 WP_000068679.1.37897 WP_000068679.1.37917 WP_000068679.1.37926 WP_000068679.1.37940 WP_000068679.1.3795 WP_000068679.1.37964 WP_000068679.1.37967 WP_000068679.1.37995 WP_000068679.1.38033 WP_000068679.1.38050 WP_000068679.1.38063 WP_000068679.1.38080 WP_000068679.1.38081 WP_000068679.1.38085 WP_000068679.1.38103 WP_000068679.1.38105 WP_000068679.1.38107 WP_000068679.1.3811 WP_000068679.1.38119 WP_000068679.1.38120 WP_000068679.1.3815 WP_000068679.1.38155 WP_000068679.1.38162 WP_000068679.1.38182 WP_000068679.1.38202 WP_000068679.1.38211 WP_000068679.1.3822 WP_000068679.1.38257 WP_000068679.1.38264 WP_000068679.1.38306 WP_000068679.1.38314 WP_000068679.1.38323 WP_000068679.1.38357 WP_000068679.1.38363 WP_000068679.1.38369 WP_000068679.1.38371 WP_000068679.1.38392 WP_000068679.1.38412 WP_000068679.1.38419 WP_000068679.1.38485 WP_000068679.1.38533 WP_000068679.1.38544 WP_000068679.1.38584 WP_000068679.1.38610 WP_000068679.1.38626 WP_000068679.1.38629 WP_000068679.1.38636 WP_000068679.1.38694 WP_000068679.1.38722 WP_000068679.1.3873 WP_000068679.1.38777 WP_000068679.1.38811 WP_000068679.1.38827 WP_000068679.1.38835 WP_000068679.1.38843 WP_000068679.1.38896 WP_000068679.1.389 WP_000068679.1.38911 WP_000068679.1.38920 WP_000068679.1.38935 WP_000068679.1.38950 WP_000068679.1.38958 WP_000068679.1.39005 WP_000068679.1.39015 WP_000068679.1.3903 WP_000068679.1.39037 WP_000068679.1.3904 WP_000068679.1.39042 WP_000068679.1.39063 WP_000068679.1.39111 WP_000068679.1.39123 WP_000068679.1.39150 WP_000068679.1.39155 WP_000068679.1.39157 WP_000068679.1.39164 WP_000068679.1.39167 WP_000068679.1.39171 WP_000068679.1.39180 WP_000068679.1.3921 WP_000068679.1.3922 WP_000068679.1.39249 WP_000068679.1.39268 WP_000068679.1.39286 WP_000068679.1.39302 WP_000068679.1.39305 WP_000068679.1.39310 WP_000068679.1.39342 WP_000068679.1.39356 WP_000068679.1.39358 WP_000068679.1.39365 WP_000068679.1.39367 WP_000068679.1.39373 WP_000068679.1.39415 WP_000068679.1.39430 WP_000068679.1.39468 WP_000068679.1.39481 WP_000068679.1.39509 WP_000068679.1.39531 WP_000068679.1.3954 WP_000068679.1.39541 WP_000068679.1.39564 WP_000068679.1.39580 WP_000068679.1.39594 WP_000068679.1.39601 WP_000068679.1.39606 WP_000068679.1.39607 WP_000068679.1.39610 WP_000068679.1.39626 WP_000068679.1.39636 WP_000068679.1.39646 WP_000068679.1.39651 WP_000068679.1.39690 WP_000068679.1.3970 WP_000068679.1.39715 WP_000068679.1.39730 WP_000068679.1.39758 WP_000068679.1.39780 WP_000068679.1.3980 WP_000068679.1.39818 WP_000068679.1.39820 WP_000068679.1.39822 WP_000068679.1.39829 WP_000068679.1.39870 WP_000068679.1.39938 WP_000068679.1.39961 WP_000068679.1.39966 WP_000068679.1.39970 WP_000068679.1.39992 WP_000068679.1.39998 WP_000068679.1.40 WP_000068679.1.40013 WP_000068679.1.40016 WP_000068679.1.40088 WP_000068679.1.40113 WP_000068679.1.40121 WP_000068679.1.40147 WP_000068679.1.40159 WP_000068679.1.40183 WP_000068679.1.40192 WP_000068679.1.4020 WP_000068679.1.40206 WP_000068679.1.40212 WP_000068679.1.40218 WP_000068679.1.40234 WP_000068679.1.40238 WP_000068679.1.40249 WP_000068679.1.40298 WP_000068679.1.4030 WP_000068679.1.40315 WP_000068679.1.40317 WP_000068679.1.40319 WP_000068679.1.40335 WP_000068679.1.40382 WP_000068679.1.40389 WP_000068679.1.40391 WP_000068679.1.40403 WP_000068679.1.40445 WP_000068679.1.4049 WP_000068679.1.40499 WP_000068679.1.40502 WP_000068679.1.40509 WP_000068679.1.40524 WP_000068679.1.40548 WP_000068679.1.40549 WP_000068679.1.40563 WP_000068679.1.40596 WP_000068679.1.40599 WP_000068679.1.406 WP_000068679.1.40617 WP_000068679.1.40623 WP_000068679.1.40629 WP_000068679.1.40666 WP_000068679.1.40668 WP_000068679.1.40686 WP_000068679.1.40712 WP_000068679.1.40742 WP_000068679.1.40758 WP_000068679.1.40781 WP_000068679.1.40793 WP_000068679.1.4081 WP_000068679.1.40813 WP_000068679.1.40815 WP_000068679.1.4082 WP_000068679.1.40865 WP_000068679.1.40882 WP_000068679.1.40898 WP_000068679.1.40900 WP_000068679.1.40912 WP_000068679.1.40937 WP_000068679.1.40952 WP_000068679.1.40965 WP_000068679.1.4103 WP_000068679.1.41037 WP_000068679.1.41045 WP_000068679.1.41060 WP_000068679.1.41125 WP_000068679.1.41147 WP_000068679.1.41206 WP_000068679.1.41230 WP_000068679.1.41239 WP_000068679.1.41244 WP_000068679.1.41259 WP_000068679.1.4126 WP_000068679.1.41263 WP_000068679.1.41271 WP_000068679.1.41287 WP_000068679.1.41294 WP_000068679.1.41315 WP_000068679.1.41330 WP_000068679.1.41339 WP_000068679.1.41346 WP_000068679.1.41363 WP_000068679.1.41368 WP_000068679.1.41371 WP_000068679.1.41372 WP_000068679.1.41391 WP_000068679.1.41392 WP_000068679.1.41402 WP_000068679.1.41407 WP_000068679.1.41417 WP_000068679.1.4142 WP_000068679.1.41436 WP_000068679.1.41449 WP_000068679.1.41455 WP_000068679.1.41457 WP_000068679.1.41466 WP_000068679.1.41478 WP_000068679.1.41479 WP_000068679.1.41484 WP_000068679.1.41513 WP_000068679.1.41530 WP_000068679.1.41536 WP_000068679.1.41539 WP_000068679.1.41545 WP_000068679.1.41556 WP_000068679.1.41566 WP_000068679.1.41606 WP_000068679.1.41613 WP_000068679.1.41621 WP_000068679.1.41651 WP_000068679.1.41712 WP_000068679.1.41718 WP_000068679.1.4172 WP_000068679.1.41734 WP_000068679.1.41740 WP_000068679.1.41752 WP_000068679.1.41778 WP_000068679.1.41780 WP_000068679.1.41782 WP_000068679.1.41784 WP_000068679.1.41809 WP_000068679.1.41812 WP_000068679.1.41813 WP_000068679.1.41826 WP_000068679.1.41849 WP_000068679.1.41900 WP_000068679.1.41923 WP_000068679.1.41960 WP_000068679.1.41964 WP_000068679.1.41988 WP_000068679.1.42022 WP_000068679.1.42027 WP_000068679.1.42033 WP_000068679.1.42036 WP_000068679.1.42038 WP_000068679.1.42060 WP_000068679.1.42073 WP_000068679.1.42095 WP_000068679.1.42096 WP_000068679.1.42113 WP_000068679.1.4213 WP_000068679.1.42138 WP_000068679.1.4214 WP_000068679.1.42159 WP_000068679.1.42179 WP_000068679.1.42203 WP_000068679.1.42209 WP_000068679.1.42214 WP_000068679.1.42226 WP_000068679.1.42233 WP_000068679.1.4224 WP_000068679.1.42252 WP_000068679.1.42277 WP_000068679.1.42284 WP_000068679.1.42300 WP_000068679.1.42318 WP_000068679.1.42359 WP_000068679.1.42367 WP_000068679.1.42369 WP_000068679.1.42376 WP_000068679.1.42387 WP_000068679.1.42413 WP_000068679.1.42415 WP_000068679.1.4242 WP_000068679.1.42432 WP_000068679.1.42442 WP_000068679.1.42447 WP_000068679.1.42448 WP_000068679.1.42456 WP_000068679.1.42480 WP_000068679.1.4250 WP_000068679.1.42513 WP_000068679.1.42522 WP_000068679.1.42594 WP_000068679.1.4261 WP_000068679.1.42632 WP_000068679.1.42661 WP_000068679.1.42669 WP_000068679.1.42728 WP_000068679.1.42748 WP_000068679.1.42749 WP_000068679.1.42750 WP_000068679.1.42756 WP_000068679.1.42761 WP_000068679.1.42771 WP_000068679.1.42791 WP_000068679.1.42813 WP_000068679.1.42828 WP_000068679.1.42830 WP_000068679.1.42832 WP_000068679.1.42863 WP_000068679.1.42879 WP_000068679.1.42891 WP_000068679.1.4290 WP_000068679.1.42918 WP_000068679.1.42936 WP_000068679.1.42937 WP_000068679.1.42950 WP_000068679.1.42962 WP_000068679.1.42966 WP_000068679.1.42975 WP_000068679.1.42987 WP_000068679.1.42989 WP_000068679.1.43013 WP_000068679.1.43035 WP_000068679.1.43079 WP_000068679.1.43121 WP_000068679.1.4313 WP_000068679.1.43132 WP_000068679.1.43133 WP_000068679.1.43137 WP_000068679.1.43140 WP_000068679.1.43166 WP_000068679.1.43174 WP_000068679.1.43177 WP_000068679.1.43196 WP_000068679.1.43239 WP_000068679.1.43270 WP_000068679.1.43316 WP_000068679.1.43324 WP_000068679.1.43363 WP_000068679.1.43374 WP_000068679.1.43384 WP_000068679.1.43389 WP_000068679.1.4342 WP_000068679.1.43444 WP_000068679.1.43448 WP_000068679.1.43455 WP_000068679.1.43469 WP_000068679.1.43473 WP_000068679.1.43474 WP_000068679.1.43489 WP_000068679.1.43536 WP_000068679.1.43561 WP_000068679.1.43566 WP_000068679.1.43598 WP_000068679.1.43604 WP_000068679.1.43622 WP_000068679.1.43642 WP_000068679.1.43720 WP_000068679.1.43738 WP_000068679.1.43750 WP_000068679.1.43754 WP_000068679.1.43769 WP_000068679.1.43798 WP_000068679.1.43804 WP_000068679.1.43816 WP_000068679.1.43837 WP_000068679.1.43858 WP_000068679.1.43911 WP_000068679.1.43925 WP_000068679.1.43939 WP_000068679.1.43989 WP_000068679.1.4400 WP_000068679.1.44018 WP_000068679.1.44020 WP_000068679.1.44029 WP_000068679.1.44040 WP_000068679.1.44075 WP_000068679.1.44077 WP_000068679.1.44088 WP_000068679.1.44096 WP_000068679.1.44100 WP_000068679.1.4411 WP_000068679.1.44115 WP_000068679.1.44125 WP_000068679.1.44130 WP_000068679.1.4415 WP_000068679.1.44162 WP_000068679.1.44165 WP_000068679.1.44201 WP_000068679.1.44203 WP_000068679.1.44211 WP_000068679.1.44222 WP_000068679.1.44238 WP_000068679.1.44251 WP_000068679.1.44264 WP_000068679.1.44273 WP_000068679.1.44285 WP_000068679.1.44287 WP_000068679.1.44292 WP_000068679.1.44314 WP_000068679.1.44324 WP_000068679.1.44365 WP_000068679.1.44389 WP_000068679.1.44424 WP_000068679.1.44426 WP_000068679.1.44445 WP_000068679.1.4445 WP_000068679.1.44452 WP_000068679.1.44461 WP_000068679.1.44488 WP_000068679.1.4449 WP_000068679.1.44524 WP_000068679.1.44539 WP_000068679.1.44561 WP_000068679.1.44570 WP_000068679.1.44587 WP_000068679.1.44608 WP_000068679.1.44610 WP_000068679.1.44627 WP_000068679.1.44661 WP_000068679.1.44668 WP_000068679.1.44671 WP_000068679.1.44686 WP_000068679.1.44717 WP_000068679.1.44724 WP_000068679.1.44733 WP_000068679.1.44759 WP_000068679.1.448 WP_000068679.1.44814 WP_000068679.1.44818 WP_000068679.1.44821 WP_000068679.1.44840 WP_000068679.1.44841 WP_000068679.1.44848 WP_000068679.1.44849 WP_000068679.1.44854 WP_000068679.1.44857 WP_000068679.1.44906 WP_000068679.1.44923 WP_000068679.1.44954 WP_000068679.1.44961 WP_000068679.1.44970 WP_000068679.1.44980 WP_000068679.1.45000 WP_000068679.1.45020 WP_000068679.1.45025 WP_000068679.1.45028 WP_000068679.1.45043 WP_000068679.1.45053 WP_000068679.1.45068 WP_000068679.1.45076 WP_000068679.1.45104 WP_000068679.1.45116 WP_000068679.1.45153 WP_000068679.1.45156 WP_000068679.1.4516 WP_000068679.1.45195 WP_000068679.1.45208 WP_000068679.1.4524 WP_000068679.1.45246 WP_000068679.1.45293 WP_000068679.1.45301 WP_000068679.1.45313 WP_000068679.1.4535 WP_000068679.1.45359 WP_000068679.1.4538 WP_000068679.1.45392 WP_000068679.1.45404 WP_000068679.1.45440 WP_000068679.1.45444 WP_000068679.1.4549 WP_000068679.1.45494 WP_000068679.1.45500 WP_000068679.1.45538 WP_000068679.1.45565 WP_000068679.1.45575 WP_000068679.1.45581 WP_000068679.1.45595 WP_000068679.1.45600 WP_000068679.1.4563 WP_000068679.1.45664 WP_000068679.1.45674 WP_000068679.1.45707 WP_000068679.1.45718 WP_000068679.1.4574 WP_000068679.1.45741 WP_000068679.1.45752 WP_000068679.1.45799 WP_000068679.1.45840 WP_000068679.1.45841 WP_000068679.1.45846 WP_000068679.1.45865 WP_000068679.1.45868 WP_000068679.1.45901 WP_000068679.1.4593 WP_000068679.1.45930 WP_000068679.1.45931 WP_000068679.1.45933 WP_000068679.1.45941 WP_000068679.1.45945 WP_000068679.1.45949 WP_000068679.1.45960 WP_000068679.1.45962 WP_000068679.1.45968 WP_000068679.1.45991 WP_000068679.1.4600 WP_000068679.1.46026 WP_000068679.1.46027 WP_000068679.1.46039 WP_000068679.1.46048 WP_000068679.1.46049 WP_000068679.1.46070 WP_000068679.1.46081 WP_000068679.1.46097 WP_000068679.1.46105 WP_000068679.1.46115 WP_000068679.1.4613 WP_000068679.1.4617 WP_000068679.1.46186 WP_000068679.1.4619 WP_000068679.1.46197 WP_000068679.1.46213 WP_000068679.1.46239 WP_000068679.1.46245 WP_000068679.1.46257 WP_000068679.1.46282 WP_000068679.1.46283 WP_000068679.1.46301 WP_000068679.1.46325 WP_000068679.1.46329 WP_000068679.1.46369 WP_000068679.1.46414 WP_000068679.1.46429 WP_000068679.1.4643 WP_000068679.1.46433 WP_000068679.1.46441 WP_000068679.1.46451 WP_000068679.1.4646 WP_000068679.1.46468 WP_000068679.1.4647 WP_000068679.1.46477 WP_000068679.1.46503 WP_000068679.1.46526 WP_000068679.1.46541 WP_000068679.1.46552 WP_000068679.1.46555 WP_000068679.1.4657 WP_000068679.1.46573 WP_000068679.1.46582 WP_000068679.1.46597 WP_000068679.1.46602 WP_000068679.1.46611 WP_000068679.1.46614 WP_000068679.1.46616 WP_000068679.1.46626 WP_000068679.1.46655 WP_000068679.1.46668 WP_000068679.1.4670 WP_000068679.1.46734 WP_000068679.1.46743 WP_000068679.1.46802 WP_000068679.1.46810 WP_000068679.1.46820 WP_000068679.1.46821 WP_000068679.1.46832 WP_000068679.1.46833 WP_000068679.1.46857 WP_000068679.1.46860 WP_000068679.1.46876 WP_000068679.1.46882 WP_000068679.1.46898 WP_000068679.1.4691 WP_000068679.1.46912 WP_000068679.1.46913 WP_000068679.1.46932 WP_000068679.1.46990 WP_000068679.1.46999 WP_000068679.1.47028 WP_000068679.1.47029 WP_000068679.1.47030 WP_000068679.1.47034 WP_000068679.1.47038 WP_000068679.1.47048 WP_000068679.1.47050 WP_000068679.1.47063 WP_000068679.1.47069 WP_000068679.1.4708 WP_000068679.1.47135 WP_000068679.1.47140 WP_000068679.1.47156 WP_000068679.1.47186 WP_000068679.1.47198 WP_000068679.1.4722 WP_000068679.1.47224 WP_000068679.1.4723 WP_000068679.1.47246 WP_000068679.1.47280 WP_000068679.1.47307 WP_000068679.1.47316 WP_000068679.1.47319 WP_000068679.1.47322 WP_000068679.1.47332 WP_000068679.1.47350 WP_000068679.1.47356 WP_000068679.1.47363 WP_000068679.1.47366 WP_000068679.1.47370 WP_000068679.1.47386 WP_000068679.1.47398 WP_000068679.1.4740 WP_000068679.1.47401 WP_000068679.1.47411 WP_000068679.1.47414 WP_000068679.1.47416 WP_000068679.1.47451 WP_000068679.1.47473 WP_000068679.1.47477 WP_000068679.1.47496 WP_000068679.1.47555 WP_000068679.1.47582 WP_000068679.1.47634 WP_000068679.1.47646 WP_000068679.1.47654 WP_000068679.1.47662 WP_000068679.1.47673 WP_000068679.1.4772 WP_000068679.1.4773 WP_000068679.1.47734 WP_000068679.1.47740 WP_000068679.1.47744 WP_000068679.1.47761 WP_000068679.1.47765 WP_000068679.1.47770 WP_000068679.1.47775 WP_000068679.1.47784 WP_000068679.1.47790 WP_000068679.1.47791 WP_000068679.1.47820 WP_000068679.1.47827 WP_000068679.1.47848 WP_000068679.1.4785 WP_000068679.1.47884 WP_000068679.1.47914 WP_000068679.1.47954 WP_000068679.1.4796 WP_000068679.1.47962 WP_000068679.1.47976 WP_000068679.1.47981 WP_000068679.1.47983 WP_000068679.1.47994 WP_000068679.1.48000 WP_000068679.1.48018 WP_000068679.1.48040 WP_000068679.1.48048 WP_000068679.1.48065 WP_000068679.1.48073 WP_000068679.1.48077 WP_000068679.1.48087 WP_000068679.1.48096 WP_000068679.1.48111 WP_000068679.1.4812 WP_000068679.1.48144 WP_000068679.1.48176 WP_000068679.1.48188 WP_000068679.1.48194 WP_000068679.1.48200 WP_000068679.1.48203 WP_000068679.1.48216 WP_000068679.1.48222 WP_000068679.1.48226 WP_000068679.1.48258 WP_000068679.1.48285 WP_000068679.1.48290 WP_000068679.1.48291 WP_000068679.1.48353 WP_000068679.1.48355 WP_000068679.1.48371 WP_000068679.1.48385 WP_000068679.1.48404 WP_000068679.1.48417 WP_000068679.1.48421 WP_000068679.1.48433 WP_000068679.1.48477 WP_000068679.1.48480 WP_000068679.1.48483 WP_000068679.1.48505 WP_000068679.1.48522 WP_000068679.1.4857 WP_000068679.1.48571 WP_000068679.1.48590 WP_000068679.1.486 WP_000068679.1.48602 WP_000068679.1.48615 WP_000068679.1.48678 WP_000068679.1.48697 WP_000068679.1.4871 WP_000068679.1.48712 WP_000068679.1.48771 WP_000068679.1.48792 WP_000068679.1.48801 WP_000068679.1.48806 WP_000068679.1.48825 WP_000068679.1.48847 WP_000068679.1.48860 WP_000068679.1.48901 WP_000068679.1.48907 WP_000068679.1.48910 WP_000068679.1.48921 WP_000068679.1.48926 WP_000068679.1.48928 WP_000068679.1.48953 WP_000068679.1.48954 WP_000068679.1.48974 WP_000068679.1.49009 WP_000068679.1.49104 WP_000068679.1.49107 WP_000068679.1.49124 WP_000068679.1.49136 WP_000068679.1.49147 WP_000068679.1.49190 WP_000068679.1.49229 WP_000068679.1.49236 WP_000068679.1.49243 WP_000068679.1.49259 WP_000068679.1.4931 WP_000068679.1.49312 WP_000068679.1.49332 WP_000068679.1.49336 WP_000068679.1.49363 WP_000068679.1.49401 WP_000068679.1.49431 WP_000068679.1.49459 WP_000068679.1.49464 WP_000068679.1.49481 WP_000068679.1.49482 WP_000068679.1.4949 WP_000068679.1.49496 WP_000068679.1.49522 WP_000068679.1.49528 WP_000068679.1.4953 WP_000068679.1.49531 WP_000068679.1.49537 WP_000068679.1.49546 WP_000068679.1.49558 WP_000068679.1.49567 WP_000068679.1.49599 WP_000068679.1.49621 WP_000068679.1.49645 WP_000068679.1.49655 WP_000068679.1.49661 WP_000068679.1.49684 WP_000068679.1.497 WP_000068679.1.49712 WP_000068679.1.49722 WP_000068679.1.49733 WP_000068679.1.49740 WP_000068679.1.49747 WP_000068679.1.49768 WP_000068679.1.49771 WP_000068679.1.49774 WP_000068679.1.49777 WP_000068679.1.49794 WP_000068679.1.49823 WP_000068679.1.49856 WP_000068679.1.49861 WP_000068679.1.49879 WP_000068679.1.49883 WP_000068679.1.49900 WP_000068679.1.49902 WP_000068679.1.49950 WP_000068679.1.49954 WP_000068679.1.50006 WP_000068679.1.50008 WP_000068679.1.5003 WP_000068679.1.50036 WP_000068679.1.50078 WP_000068679.1.50098 WP_000068679.1.50110 WP_000068679.1.50113 WP_000068679.1.50119 WP_000068679.1.50136 WP_000068679.1.5017 WP_000068679.1.50182 WP_000068679.1.50196 WP_000068679.1.50207 WP_000068679.1.50228 WP_000068679.1.50230 WP_000068679.1.50258 WP_000068679.1.50262 WP_000068679.1.50266 WP_000068679.1.50269 WP_000068679.1.50273 WP_000068679.1.50278 WP_000068679.1.50304 WP_000068679.1.50329 WP_000068679.1.50345 WP_000068679.1.50353 WP_000068679.1.50358 WP_000068679.1.50361 WP_000068679.1.50366 WP_000068679.1.5037 WP_000068679.1.50380 WP_000068679.1.50381 WP_000068679.1.5040 WP_000068679.1.5041 WP_000068679.1.50412 WP_000068679.1.50418 WP_000068679.1.50446 WP_000068679.1.50452 WP_000068679.1.5046 WP_000068679.1.50539 WP_000068679.1.50548 WP_000068679.1.50549 WP_000068679.1.5056 WP_000068679.1.50564 WP_000068679.1.50579 WP_000068679.1.50586 WP_000068679.1.506 WP_000068679.1.5061 WP_000068679.1.50616 WP_000068679.1.5064 WP_000068679.1.5067 WP_000068679.1.50725 WP_000068679.1.50762 WP_000068679.1.50887 WP_000068679.1.50936 WP_000068679.1.50939 WP_000068679.1.5095 WP_000068679.1.50969 WP_000068679.1.50986 WP_000068679.1.50993 WP_000068679.1.50996 WP_000068679.1.51013 WP_000068679.1.51027 WP_000068679.1.51042 WP_000068679.1.51058 WP_000068679.1.5106 WP_000068679.1.51109 WP_000068679.1.51127 WP_000068679.1.51154 WP_000068679.1.51171 WP_000068679.1.51172 WP_000068679.1.51175 WP_000068679.1.51201 WP_000068679.1.51206 WP_000068679.1.51248 WP_000068679.1.51255 WP_000068679.1.51260 WP_000068679.1.51278 WP_000068679.1.5128 WP_000068679.1.51299 WP_000068679.1.51300 WP_000068679.1.51307 WP_000068679.1.51320 WP_000068679.1.51323 WP_000068679.1.51325 WP_000068679.1.51336 WP_000068679.1.51354 WP_000068679.1.51364 WP_000068679.1.51380 WP_000068679.1.51405 WP_000068679.1.51425 WP_000068679.1.51427 WP_000068679.1.51430 WP_000068679.1.51441 WP_000068679.1.5146 WP_000068679.1.51462 WP_000068679.1.51482 WP_000068679.1.51490 WP_000068679.1.51495 WP_000068679.1.51503 WP_000068679.1.51505 WP_000068679.1.51513 WP_000068679.1.51525 WP_000068679.1.51537 WP_000068679.1.51539 WP_000068679.1.51542 WP_000068679.1.51548 WP_000068679.1.51552 WP_000068679.1.5157 WP_000068679.1.51580 WP_000068679.1.51587 WP_000068679.1.51600 WP_000068679.1.51624 WP_000068679.1.51629 WP_000068679.1.51643 WP_000068679.1.51662 WP_000068679.1.51693 WP_000068679.1.51707 WP_000068679.1.51718 WP_000068679.1.5172 WP_000068679.1.51736 WP_000068679.1.51760 WP_000068679.1.51784 WP_000068679.1.51834 WP_000068679.1.51837 WP_000068679.1.51839 WP_000068679.1.51869 WP_000068679.1.51873 WP_000068679.1.51881 WP_000068679.1.51896 WP_000068679.1.51899 WP_000068679.1.51906 WP_000068679.1.51944 WP_000068679.1.51968 WP_000068679.1.51985 WP_000068679.1.51988 WP_000068679.1.5199 WP_000068679.1.51999 WP_000068679.1.52002 WP_000068679.1.52011 WP_000068679.1.52020 WP_000068679.1.52039 WP_000068679.1.52044 WP_000068679.1.52062 WP_000068679.1.52076 WP_000068679.1.52111 WP_000068679.1.52126 WP_000068679.1.52127 WP_000068679.1.52135 WP_000068679.1.52137 WP_000068679.1.5217 WP_000068679.1.52171 WP_000068679.1.52186 WP_000068679.1.52200 WP_000068679.1.52211 WP_000068679.1.52213 WP_000068679.1.52214 WP_000068679.1.52225 WP_000068679.1.52230 WP_000068679.1.52236 WP_000068679.1.52240 WP_000068679.1.52243 WP_000068679.1.52249 WP_000068679.1.5227 WP_000068679.1.52272 WP_000068679.1.52304 WP_000068679.1.52305 WP_000068679.1.52324 WP_000068679.1.52328 WP_000068679.1.52333 WP_000068679.1.52363 WP_000068679.1.52378 WP_000068679.1.5239 WP_000068679.1.52399 WP_000068679.1.52406 WP_000068679.1.52413 WP_000068679.1.52419 WP_000068679.1.52421 WP_000068679.1.52492 WP_000068679.1.52496 WP_000068679.1.52524 WP_000068679.1.52543 WP_000068679.1.52554 WP_000068679.1.52558 WP_000068679.1.52567 WP_000068679.1.52601 WP_000068679.1.52612 WP_000068679.1.5265 WP_000068679.1.52662 WP_000068679.1.52691 WP_000068679.1.52704 WP_000068679.1.52710 WP_000068679.1.5272 WP_000068679.1.52735 WP_000068679.1.52755 WP_000068679.1.52762 WP_000068679.1.52774 WP_000068679.1.52777 WP_000068679.1.52780 WP_000068679.1.52801 WP_000068679.1.52844 WP_000068679.1.52846 WP_000068679.1.52852 WP_000068679.1.52881 WP_000068679.1.52883 WP_000068679.1.52895 WP_000068679.1.52908 WP_000068679.1.5291 WP_000068679.1.52913 WP_000068679.1.52933 WP_000068679.1.52942 WP_000068679.1.52962 WP_000068679.1.52995 WP_000068679.1.52996 WP_000068679.1.53012 WP_000068679.1.53020 WP_000068679.1.53027 WP_000068679.1.53065 WP_000068679.1.53084 WP_000068679.1.53099 WP_000068679.1.5310 WP_000068679.1.53110 WP_000068679.1.53155 WP_000068679.1.53181 WP_000068679.1.53186 WP_000068679.1.532 WP_000068679.1.53211 WP_000068679.1.5322 WP_000068679.1.53223 WP_000068679.1.53228 WP_000068679.1.53238 WP_000068679.1.53242 WP_000068679.1.53244 WP_000068679.1.53251 WP_000068679.1.53252 WP_000068679.1.53262 WP_000068679.1.53270 WP_000068679.1.53277 WP_000068679.1.53308 WP_000068679.1.53327 WP_000068679.1.53356 WP_000068679.1.53364 WP_000068679.1.53377 WP_000068679.1.53401 WP_000068679.1.53410 WP_000068679.1.53419 WP_000068679.1.5342 WP_000068679.1.53428 WP_000068679.1.53431 WP_000068679.1.53482 WP_000068679.1.53505 WP_000068679.1.5351 WP_000068679.1.53535 WP_000068679.1.53537 WP_000068679.1.53545 WP_000068679.1.53574 WP_000068679.1.53582 WP_000068679.1.53590 WP_000068679.1.53594 WP_000068679.1.5362 WP_000068679.1.53642 WP_000068679.1.53645 WP_000068679.1.53706 WP_000068679.1.53769 WP_000068679.1.53809 WP_000068679.1.53810 WP_000068679.1.53811 WP_000068679.1.53841 WP_000068679.1.53863 WP_000068679.1.53866 WP_000068679.1.53878 WP_000068679.1.53884 WP_000068679.1.5393 WP_000068679.1.53931 WP_000068679.1.5395 WP_000068679.1.53966 WP_000068679.1.53968 WP_000068679.1.53972 WP_000068679.1.53978 WP_000068679.1.53994 WP_000068679.1.54002 WP_000068679.1.54013 WP_000068679.1.54023 WP_000068679.1.54024 WP_000068679.1.54028 WP_000068679.1.54032 WP_000068679.1.54072 WP_000068679.1.54091 WP_000068679.1.54102 WP_000068679.1.54144 WP_000068679.1.54169 WP_000068679.1.54185 WP_000068679.1.54202 WP_000068679.1.54213 WP_000068679.1.54307 WP_000068679.1.54317 WP_000068679.1.54328 WP_000068679.1.54329 WP_000068679.1.5433 WP_000068679.1.54344 WP_000068679.1.54359 WP_000068679.1.5440 WP_000068679.1.5441 WP_000068679.1.54454 WP_000068679.1.54463 WP_000068679.1.54476 WP_000068679.1.54507 WP_000068679.1.54546 WP_000068679.1.54585 WP_000068679.1.54591 WP_000068679.1.5460 WP_000068679.1.54602 WP_000068679.1.54605 WP_000068679.1.5461 WP_000068679.1.54614 WP_000068679.1.54617 WP_000068679.1.54620 WP_000068679.1.54625 WP_000068679.1.54638 WP_000068679.1.54641 WP_000068679.1.5467 WP_000068679.1.54688 WP_000068679.1.5470 WP_000068679.1.54708 WP_000068679.1.54725 WP_000068679.1.54729 WP_000068679.1.54755 WP_000068679.1.54769 WP_000068679.1.5479 WP_000068679.1.54798 WP_000068679.1.54817 WP_000068679.1.54829 WP_000068679.1.5486 WP_000068679.1.54883 WP_000068679.1.54918 WP_000068679.1.54921 WP_000068679.1.54927 WP_000068679.1.54941 WP_000068679.1.54946 WP_000068679.1.54981 WP_000068679.1.54989 WP_000068679.1.54991 WP_000068679.1.55003 WP_000068679.1.55005 WP_000068679.1.55009 WP_000068679.1.55041 WP_000068679.1.55070 WP_000068679.1.55112 WP_000068679.1.55115 WP_000068679.1.55134 WP_000068679.1.55144 WP_000068679.1.55177 WP_000068679.1.55185 WP_000068679.1.55197 WP_000068679.1.5520 WP_000068679.1.55203 WP_000068679.1.55218 WP_000068679.1.55222 WP_000068679.1.55226 WP_000068679.1.55286 WP_000068679.1.55291 WP_000068679.1.55338 WP_000068679.1.55342 WP_000068679.1.55357 WP_000068679.1.55359 WP_000068679.1.55374 WP_000068679.1.55381 WP_000068679.1.55417 WP_000068679.1.55425 WP_000068679.1.55466 WP_000068679.1.55482 WP_000068679.1.55483 WP_000068679.1.55489 WP_000068679.1.55492 WP_000068679.1.55507 WP_000068679.1.55529 WP_000068679.1.55550 WP_000068679.1.55551 WP_000068679.1.55552 WP_000068679.1.55556 WP_000068679.1.55560 WP_000068679.1.55571 WP_000068679.1.55574 WP_000068679.1.55581 WP_000068679.1.55597 WP_000068679.1.55608 WP_000068679.1.5561 WP_000068679.1.55629 WP_000068679.1.5566 WP_000068679.1.55676 WP_000068679.1.5570 WP_000068679.1.55709 WP_000068679.1.55720 WP_000068679.1.55727 WP_000068679.1.55730 WP_000068679.1.55731 WP_000068679.1.55757 WP_000068679.1.55787 WP_000068679.1.55791 WP_000068679.1.55820 WP_000068679.1.55825 WP_000068679.1.55838 WP_000068679.1.55844 WP_000068679.1.55868 WP_000068679.1.55870 WP_000068679.1.55892 WP_000068679.1.55897 WP_000068679.1.55979 WP_000068679.1.55988 WP_000068679.1.56072 WP_000068679.1.561 WP_000068679.1.56101 WP_000068679.1.56122 WP_000068679.1.5614 WP_000068679.1.56149 WP_000068679.1.56151 WP_000068679.1.5616 WP_000068679.1.56164 WP_000068679.1.56177 WP_000068679.1.56193 WP_000068679.1.56197 WP_000068679.1.56216 WP_000068679.1.56231 WP_000068679.1.56285 WP_000068679.1.56345 WP_000068679.1.56358 WP_000068679.1.56371 WP_000068679.1.56388 WP_000068679.1.5639 WP_000068679.1.56390 WP_000068679.1.56392 WP_000068679.1.56399 WP_000068679.1.56436 WP_000068679.1.56439 WP_000068679.1.56446 WP_000068679.1.5646 WP_000068679.1.56481 WP_000068679.1.56489 WP_000068679.1.5649 WP_000068679.1.56491 WP_000068679.1.56501 WP_000068679.1.56513 WP_000068679.1.56528 WP_000068679.1.56543 WP_000068679.1.56554 WP_000068679.1.56571 WP_000068679.1.56573 WP_000068679.1.56586 WP_000068679.1.56665 WP_000068679.1.56680 WP_000068679.1.56689 WP_000068679.1.5670 WP_000068679.1.56704 WP_000068679.1.56713 WP_000068679.1.56721 WP_000068679.1.56742 WP_000068679.1.56776 WP_000068679.1.56777 WP_000068679.1.56786 WP_000068679.1.56787 WP_000068679.1.56789 WP_000068679.1.56799 WP_000068679.1.56830 WP_000068679.1.56835 WP_000068679.1.56846 WP_000068679.1.5685 WP_000068679.1.56871 WP_000068679.1.56882 WP_000068679.1.56908 WP_000068679.1.56932 WP_000068679.1.56934 WP_000068679.1.56937 WP_000068679.1.56951 WP_000068679.1.56978 WP_000068679.1.56980 WP_000068679.1.56992 WP_000068679.1.57032 WP_000068679.1.57051 WP_000068679.1.57068 WP_000068679.1.57071 WP_000068679.1.57072 WP_000068679.1.57086 WP_000068679.1.57100 WP_000068679.1.57124 WP_000068679.1.57150 WP_000068679.1.57180 WP_000068679.1.57181 WP_000068679.1.57185 WP_000068679.1.57197 WP_000068679.1.57216 WP_000068679.1.57222 WP_000068679.1.57254 WP_000068679.1.57269 WP_000068679.1.57280 WP_000068679.1.57281 WP_000068679.1.57319 WP_000068679.1.57348 WP_000068679.1.57349 WP_000068679.1.57386 WP_000068679.1.57395 WP_000068679.1.57403 WP_000068679.1.57410 WP_000068679.1.57414 WP_000068679.1.57432 WP_000068679.1.57438 WP_000068679.1.57453 WP_000068679.1.57466 WP_000068679.1.57487 WP_000068679.1.57538 WP_000068679.1.5755 WP_000068679.1.57558 WP_000068679.1.57574 WP_000068679.1.57588 WP_000068679.1.57610 WP_000068679.1.57628 WP_000068679.1.57629 WP_000068679.1.57634 WP_000068679.1.57638 WP_000068679.1.5764 WP_000068679.1.57646 WP_000068679.1.57659 WP_000068679.1.57663 WP_000068679.1.57669 WP_000068679.1.57719 WP_000068679.1.57738 WP_000068679.1.57812 WP_000068679.1.57836 WP_000068679.1.57846 WP_000068679.1.57851 WP_000068679.1.57898 WP_000068679.1.57903 WP_000068679.1.57904 WP_000068679.1.57920 WP_000068679.1.57951 WP_000068679.1.57975 WP_000068679.1.58001 WP_000068679.1.58009 WP_000068679.1.58022 WP_000068679.1.58045 WP_000068679.1.58048 WP_000068679.1.58057 WP_000068679.1.58060 WP_000068679.1.58080 WP_000068679.1.5810 WP_000068679.1.58107 WP_000068679.1.5812 WP_000068679.1.58128 WP_000068679.1.58136 WP_000068679.1.58143 WP_000068679.1.58146 WP_000068679.1.58163 WP_000068679.1.58169 WP_000068679.1.58172 WP_000068679.1.58206 WP_000068679.1.58226 WP_000068679.1.58232 WP_000068679.1.58238 WP_000068679.1.58267 WP_000068679.1.58316 WP_000068679.1.58368 WP_000068679.1.58371 WP_000068679.1.58384 WP_000068679.1.584 WP_000068679.1.58401 WP_000068679.1.58408 WP_000068679.1.5842 WP_000068679.1.58420 WP_000068679.1.58423 WP_000068679.1.58429 WP_000068679.1.58440 WP_000068679.1.58445 WP_000068679.1.58475 WP_000068679.1.58484 WP_000068679.1.58493 WP_000068679.1.58496 WP_000068679.1.58507 WP_000068679.1.58514 WP_000068679.1.5852 WP_000068679.1.58528 WP_000068679.1.58547 WP_000068679.1.58552 WP_000068679.1.58572 WP_000068679.1.58582 WP_000068679.1.58622 WP_000068679.1.58680 WP_000068679.1.58705 WP_000068679.1.58707 WP_000068679.1.58723 WP_000068679.1.58837 WP_000068679.1.58867 WP_000068679.1.58870 WP_000068679.1.58901 WP_000068679.1.58940 WP_000068679.1.58942 WP_000068679.1.58951 WP_000068679.1.58958 WP_000068679.1.58976 WP_000068679.1.58977 WP_000068679.1.58983 WP_000068679.1.59024 WP_000068679.1.59026 WP_000068679.1.59038 WP_000068679.1.59047 WP_000068679.1.5906 WP_000068679.1.59083 WP_000068679.1.59119 WP_000068679.1.59165 WP_000068679.1.59174 WP_000068679.1.59190 WP_000068679.1.59199 WP_000068679.1.59218 WP_000068679.1.59226 WP_000068679.1.5927 WP_000068679.1.59280 WP_000068679.1.59291 WP_000068679.1.59293 WP_000068679.1.59302 WP_000068679.1.59306 WP_000068679.1.59359 WP_000068679.1.59374 WP_000068679.1.59395 WP_000068679.1.59396 WP_000068679.1.59407 WP_000068679.1.59409 WP_000068679.1.59413 WP_000068679.1.59423 WP_000068679.1.59434 WP_000068679.1.59470 WP_000068679.1.59483 WP_000068679.1.59491 WP_000068679.1.59513 WP_000068679.1.59533 WP_000068679.1.59553 WP_000068679.1.59590 WP_000068679.1.59615 WP_000068679.1.59621 WP_000068679.1.59638 WP_000068679.1.5965 WP_000068679.1.59679 WP_000068679.1.59689 WP_000068679.1.59699 WP_000068679.1.597 WP_000068679.1.59730 WP_000068679.1.59733 WP_000068679.1.59737 WP_000068679.1.59756 WP_000068679.1.59781 WP_000068679.1.59782 WP_000068679.1.59791 WP_000068679.1.59823 WP_000068679.1.59836 WP_000068679.1.59838 WP_000068679.1.59855 WP_000068679.1.59877 WP_000068679.1.59894 WP_000068679.1.5990 WP_000068679.1.59905 WP_000068679.1.59912 WP_000068679.1.59914 WP_000068679.1.59931 WP_000068679.1.59932 WP_000068679.1.59959 WP_000068679.1.59970 WP_000068679.1.59989 WP_000068679.1.59998 WP_000068679.1.60005 WP_000068679.1.6002 WP_000068679.1.60023 WP_000068679.1.60031 WP_000068679.1.60042 WP_000068679.1.60043 WP_000068679.1.60067 WP_000068679.1.60070 WP_000068679.1.60095 WP_000068679.1.60117 WP_000068679.1.6013 WP_000068679.1.60151 WP_000068679.1.60186 WP_000068679.1.6022 WP_000068679.1.60228 WP_000068679.1.60246 WP_000068679.1.60304 WP_000068679.1.60325 WP_000068679.1.60342 WP_000068679.1.60343 WP_000068679.1.60374 WP_000068679.1.60387 WP_000068679.1.60411 WP_000068679.1.60436 WP_000068679.1.60443 WP_000068679.1.60453 WP_000068679.1.60457 WP_000068679.1.60461 WP_000068679.1.60477 WP_000068679.1.60491 WP_000068679.1.60498 WP_000068679.1.60505 WP_000068679.1.60550 WP_000068679.1.60559 WP_000068679.1.60567 WP_000068679.1.60570 WP_000068679.1.60576 WP_000068679.1.60599 WP_000068679.1.60606 WP_000068679.1.6061 WP_000068679.1.60613 WP_000068679.1.60614 WP_000068679.1.6064 WP_000068679.1.60644 WP_000068679.1.60647 WP_000068679.1.6066 WP_000068679.1.60671 WP_000068679.1.60684 WP_000068679.1.60698 WP_000068679.1.60717 WP_000068679.1.60732 WP_000068679.1.60744 WP_000068679.1.60761 WP_000068679.1.60764 WP_000068679.1.60771 WP_000068679.1.60805 WP_000068679.1.60816 WP_000068679.1.60826 WP_000068679.1.60832 WP_000068679.1.60835 WP_000068679.1.60847 WP_000068679.1.60872 WP_000068679.1.60895 WP_000068679.1.60901 WP_000068679.1.60921 WP_000068679.1.60925 WP_000068679.1.60927 WP_000068679.1.60935 WP_000068679.1.6094 WP_000068679.1.60974 WP_000068679.1.61005 WP_000068679.1.61008 WP_000068679.1.61035 WP_000068679.1.61039 WP_000068679.1.61046 WP_000068679.1.61058 WP_000068679.1.6106 WP_000068679.1.61096 WP_000068679.1.61099 WP_000068679.1.6110 WP_000068679.1.61102 WP_000068679.1.61108 WP_000068679.1.61112 WP_000068679.1.61148 WP_000068679.1.61170 WP_000068679.1.61174 WP_000068679.1.61181 WP_000068679.1.61183 WP_000068679.1.61186 WP_000068679.1.61223 WP_000068679.1.61225 WP_000068679.1.61241 WP_000068679.1.61253 WP_000068679.1.61268 WP_000068679.1.61292 WP_000068679.1.613 WP_000068679.1.61360 WP_000068679.1.61362 WP_000068679.1.61373 WP_000068679.1.61398 WP_000068679.1.61496 WP_000068679.1.61512 WP_000068679.1.61517 WP_000068679.1.61524 WP_000068679.1.61551 WP_000068679.1.61608 WP_000068679.1.61612 WP_000068679.1.61623 WP_000068679.1.61636 WP_000068679.1.61643 WP_000068679.1.61663 WP_000068679.1.61703 WP_000068679.1.61718 WP_000068679.1.61758 WP_000068679.1.61770 WP_000068679.1.61779 WP_000068679.1.618 WP_000068679.1.61806 WP_000068679.1.61853 WP_000068679.1.61858 WP_000068679.1.61874 WP_000068679.1.61893 WP_000068679.1.61926 WP_000068679.1.61939 WP_000068679.1.61948 WP_000068679.1.61949 WP_000068679.1.61955 WP_000068679.1.61957 WP_000068679.1.61966 WP_000068679.1.62038 WP_000068679.1.62041 WP_000068679.1.62099 WP_000068679.1.6212 WP_000068679.1.62135 WP_000068679.1.62157 WP_000068679.1.62182 WP_000068679.1.62207 WP_000068679.1.62236 WP_000068679.1.62264 WP_000068679.1.62266 WP_000068679.1.62282 WP_000068679.1.62290 WP_000068679.1.62296 WP_000068679.1.62303 WP_000068679.1.62337 WP_000068679.1.62348 WP_000068679.1.62358 WP_000068679.1.62447 WP_000068679.1.6245 WP_000068679.1.62460 WP_000068679.1.62480 WP_000068679.1.62487 WP_000068679.1.62503 WP_000068679.1.62507 WP_000068679.1.62513 WP_000068679.1.62514 WP_000068679.1.62529 WP_000068679.1.62586 WP_000068679.1.6261 WP_000068679.1.62612 WP_000068679.1.62646 WP_000068679.1.62668 WP_000068679.1.62675 WP_000068679.1.62681 WP_000068679.1.62714 WP_000068679.1.62735 WP_000068679.1.62750 WP_000068679.1.62762 WP_000068679.1.62769 WP_000068679.1.62787 WP_000068679.1.62802 WP_000068679.1.62812 WP_000068679.1.62818 WP_000068679.1.62840 WP_000068679.1.62843 WP_000068679.1.62850 WP_000068679.1.62851 WP_000068679.1.62888 WP_000068679.1.62914 WP_000068679.1.62919 WP_000068679.1.6293 WP_000068679.1.62931 WP_000068679.1.62951 WP_000068679.1.62959 WP_000068679.1.62973 WP_000068679.1.62989 WP_000068679.1.6299 WP_000068679.1.62992 WP_000068679.1.63023 WP_000068679.1.63078 WP_000068679.1.63167 WP_000068679.1.63177 WP_000068679.1.63189 WP_000068679.1.63246 WP_000068679.1.63287 WP_000068679.1.6331 WP_000068679.1.63310 WP_000068679.1.6334 WP_000068679.1.63350 WP_000068679.1.6337 WP_000068679.1.63370 WP_000068679.1.63374 WP_000068679.1.63393 WP_000068679.1.63419 WP_000068679.1.63435 WP_000068679.1.63437 WP_000068679.1.63445 WP_000068679.1.63453 WP_000068679.1.63466 WP_000068679.1.63467 WP_000068679.1.63470 WP_000068679.1.63478 WP_000068679.1.63484 WP_000068679.1.63491 WP_000068679.1.63536 WP_000068679.1.63554 WP_000068679.1.63556 WP_000068679.1.63563 WP_000068679.1.63576 WP_000068679.1.63586 WP_000068679.1.63602 WP_000068679.1.63612 WP_000068679.1.63615 WP_000068679.1.6364 WP_000068679.1.63666 WP_000068679.1.63679 WP_000068679.1.63683 WP_000068679.1.63703 WP_000068679.1.63721 WP_000068679.1.63746 WP_000068679.1.63800 WP_000068679.1.63810 WP_000068679.1.63821 WP_000068679.1.63871 WP_000068679.1.63872 WP_000068679.1.63957 WP_000068679.1.63964 WP_000068679.1.63969 WP_000068679.1.63990 WP_000068679.1.64008 WP_000068679.1.64014 WP_000068679.1.64040 WP_000068679.1.64050 WP_000068679.1.64074 WP_000068679.1.64086 WP_000068679.1.64110 WP_000068679.1.64150 WP_000068679.1.64153 WP_000068679.1.6416 WP_000068679.1.64161 WP_000068679.1.64175 WP_000068679.1.64193 WP_000068679.1.64280 WP_000068679.1.64285 WP_000068679.1.64286 WP_000068679.1.6431 WP_000068679.1.64321 WP_000068679.1.64337 WP_000068679.1.64353 WP_000068679.1.64355 WP_000068679.1.64356 WP_000068679.1.64371 WP_000068679.1.64380 WP_000068679.1.64391 WP_000068679.1.6441 WP_000068679.1.64437 WP_000068679.1.64448 WP_000068679.1.6445 WP_000068679.1.64458 WP_000068679.1.64528 WP_000068679.1.64540 WP_000068679.1.64563 WP_000068679.1.64621 WP_000068679.1.64634 WP_000068679.1.64657 WP_000068679.1.6469 WP_000068679.1.64693 WP_000068679.1.64707 WP_000068679.1.64746 WP_000068679.1.64749 WP_000068679.1.64784 WP_000068679.1.64789 WP_000068679.1.64793 WP_000068679.1.64821 WP_000068679.1.64866 WP_000068679.1.64875 WP_000068679.1.64881 WP_000068679.1.64895 WP_000068679.1.64912 WP_000068679.1.64926 WP_000068679.1.64930 WP_000068679.1.64939 WP_000068679.1.64946 WP_000068679.1.64970 WP_000068679.1.6499 WP_000068679.1.64990 WP_000068679.1.65023 WP_000068679.1.65035 WP_000068679.1.65056 WP_000068679.1.65084 WP_000068679.1.65097 WP_000068679.1.651 WP_000068679.1.6511 WP_000068679.1.65110 WP_000068679.1.65118 WP_000068679.1.65135 WP_000068679.1.65151 WP_000068679.1.65155 WP_000068679.1.6516 WP_000068679.1.65179 WP_000068679.1.65192 WP_000068679.1.65194 WP_000068679.1.65206 WP_000068679.1.65256 WP_000068679.1.65271 WP_000068679.1.65296 WP_000068679.1.65305 WP_000068679.1.65306 WP_000068679.1.65353 WP_000068679.1.65355 WP_000068679.1.65364 WP_000068679.1.6537 WP_000068679.1.65370 WP_000068679.1.65372 WP_000068679.1.654 WP_000068679.1.65408 WP_000068679.1.65413 WP_000068679.1.65415 WP_000068679.1.65484 WP_000068679.1.65493 WP_000068679.1.6553 WP_000068679.1.65531 WP_000068679.1.65546 WP_000068679.1.65581 WP_000068679.1.65596 WP_000068679.1.6563 WP_000068679.1.65662 WP_000068679.1.65667 WP_000068679.1.65672 WP_000068679.1.65677 WP_000068679.1.65708 WP_000068679.1.65714 WP_000068679.1.65762 WP_000068679.1.6587 WP_000068679.1.65875 WP_000068679.1.65898 WP_000068679.1.65912 WP_000068679.1.65954 WP_000068679.1.65961 WP_000068679.1.65963 WP_000068679.1.65978 WP_000068679.1.65988 WP_000068679.1.6599 WP_000068679.1.65991 WP_000068679.1.66001 WP_000068679.1.66007 WP_000068679.1.66033 WP_000068679.1.6604 WP_000068679.1.66050 WP_000068679.1.66059 WP_000068679.1.6609 WP_000068679.1.66094 WP_000068679.1.66100 WP_000068679.1.66102 WP_000068679.1.66104 WP_000068679.1.66105 WP_000068679.1.66127 WP_000068679.1.66181 WP_000068679.1.66187 WP_000068679.1.66197 WP_000068679.1.6622 WP_000068679.1.66251 WP_000068679.1.66264 WP_000068679.1.66280 WP_000068679.1.66288 WP_000068679.1.66327 WP_000068679.1.66335 WP_000068679.1.6635 WP_000068679.1.66387 WP_000068679.1.66395 WP_000068679.1.66432 WP_000068679.1.6645 WP_000068679.1.66501 WP_000068679.1.66531 WP_000068679.1.6654 WP_000068679.1.66550 WP_000068679.1.66559 WP_000068679.1.66566 WP_000068679.1.66579 WP_000068679.1.66624 WP_000068679.1.6665 WP_000068679.1.66700 WP_000068679.1.66719 WP_000068679.1.66758 WP_000068679.1.6676 WP_000068679.1.66783 WP_000068679.1.66791 WP_000068679.1.66795 WP_000068679.1.66849 WP_000068679.1.66873 WP_000068679.1.66922 WP_000068679.1.66933 WP_000068679.1.66948 WP_000068679.1.66975 WP_000068679.1.66978 WP_000068679.1.6701 WP_000068679.1.67018 WP_000068679.1.67021 WP_000068679.1.67022 WP_000068679.1.67026 WP_000068679.1.67055 WP_000068679.1.67073 WP_000068679.1.67102 WP_000068679.1.67116 WP_000068679.1.67120 WP_000068679.1.67136 WP_000068679.1.67137 WP_000068679.1.67149 WP_000068679.1.67150 WP_000068679.1.67158 WP_000068679.1.67164 WP_000068679.1.67193 WP_000068679.1.67194 WP_000068679.1.67200 WP_000068679.1.67209 WP_000068679.1.67210 WP_000068679.1.67214 WP_000068679.1.6723 WP_000068679.1.67272 WP_000068679.1.67278 WP_000068679.1.67293 WP_000068679.1.6735 WP_000068679.1.67383 WP_000068679.1.67412 WP_000068679.1.67415 WP_000068679.1.67446 WP_000068679.1.67452 WP_000068679.1.67454 WP_000068679.1.67462 WP_000068679.1.67467 WP_000068679.1.67468 WP_000068679.1.67522 WP_000068679.1.67533 WP_000068679.1.67549 WP_000068679.1.67553 WP_000068679.1.67581 WP_000068679.1.67660 WP_000068679.1.67663 WP_000068679.1.67676 WP_000068679.1.6769 WP_000068679.1.67701 WP_000068679.1.67704 WP_000068679.1.67724 WP_000068679.1.67726 WP_000068679.1.67732 WP_000068679.1.67753 WP_000068679.1.67775 WP_000068679.1.67780 WP_000068679.1.67786 WP_000068679.1.67787 WP_000068679.1.67788 WP_000068679.1.678 WP_000068679.1.67802 WP_000068679.1.67841 WP_000068679.1.67853 WP_000068679.1.67894 WP_000068679.1.67901 WP_000068679.1.67938 WP_000068679.1.67971 WP_000068679.1.67975 WP_000068679.1.67984 WP_000068679.1.67990 WP_000068679.1.67999 WP_000068679.1.68008 WP_000068679.1.68011 WP_000068679.1.6802 WP_000068679.1.68025 WP_000068679.1.6803 WP_000068679.1.68039 WP_000068679.1.68052 WP_000068679.1.68053 WP_000068679.1.68058 WP_000068679.1.68067 WP_000068679.1.68069 WP_000068679.1.68079 WP_000068679.1.68096 WP_000068679.1.68108 WP_000068679.1.68126 WP_000068679.1.68145 WP_000068679.1.68170 WP_000068679.1.68175 WP_000068679.1.682 WP_000068679.1.68215 WP_000068679.1.68231 WP_000068679.1.68241 WP_000068679.1.68255 WP_000068679.1.68271 WP_000068679.1.68278 WP_000068679.1.68281 WP_000068679.1.68283 WP_000068679.1.68300 WP_000068679.1.68336 WP_000068679.1.68341 WP_000068679.1.68347 WP_000068679.1.68369 WP_000068679.1.68396 WP_000068679.1.68411 WP_000068679.1.68442 WP_000068679.1.68482 WP_000068679.1.68490 WP_000068679.1.68493 WP_000068679.1.68523 WP_000068679.1.68534 WP_000068679.1.68566 WP_000068679.1.68584 WP_000068679.1.6859 WP_000068679.1.68598 WP_000068679.1.6860 WP_000068679.1.68609 WP_000068679.1.68630 WP_000068679.1.68635 WP_000068679.1.68673 WP_000068679.1.68678 WP_000068679.1.68679 WP_000068679.1.68695 WP_000068679.1.68697 WP_000068679.1.68711 WP_000068679.1.68731 WP_000068679.1.68751 WP_000068679.1.68752 WP_000068679.1.6877 WP_000068679.1.68797 WP_000068679.1.6880 WP_000068679.1.68801 WP_000068679.1.68865 WP_000068679.1.6887 WP_000068679.1.68873 WP_000068679.1.68877 WP_000068679.1.68880 WP_000068679.1.68915 WP_000068679.1.68936 WP_000068679.1.68956 WP_000068679.1.68961 WP_000068679.1.6897 WP_000068679.1.68989 WP_000068679.1.69033 WP_000068679.1.69039 WP_000068679.1.69054 WP_000068679.1.69098 WP_000068679.1.69126 WP_000068679.1.69127 WP_000068679.1.69144 WP_000068679.1.6916 WP_000068679.1.69160 WP_000068679.1.6919 WP_000068679.1.69192 WP_000068679.1.69221 WP_000068679.1.6923 WP_000068679.1.69247 WP_000068679.1.69258 WP_000068679.1.69261 WP_000068679.1.6929 WP_000068679.1.69303 WP_000068679.1.69305 WP_000068679.1.69350 WP_000068679.1.69351 WP_000068679.1.69390 WP_000068679.1.694 WP_000068679.1.69404 WP_000068679.1.69441 WP_000068679.1.6945 WP_000068679.1.69472 WP_000068679.1.69473 WP_000068679.1.69502 WP_000068679.1.69537 WP_000068679.1.69551 WP_000068679.1.69583 WP_000068679.1.69589 WP_000068679.1.69593 WP_000068679.1.69646 WP_000068679.1.69649 WP_000068679.1.69655 WP_000068679.1.69689 WP_000068679.1.69730 WP_000068679.1.69780 WP_000068679.1.69786 WP_000068679.1.69803 WP_000068679.1.69810 WP_000068679.1.69818 WP_000068679.1.69868 WP_000068679.1.69887 WP_000068679.1.69896 WP_000068679.1.6993 WP_000068679.1.69972 WP_000068679.1.69979 WP_000068679.1.70063 WP_000068679.1.70081 WP_000068679.1.70123 WP_000068679.1.70125 WP_000068679.1.70149 WP_000068679.1.70190 WP_000068679.1.70191 WP_000068679.1.70213 WP_000068679.1.70251 WP_000068679.1.70256 WP_000068679.1.70300 WP_000068679.1.70341 WP_000068679.1.70357 WP_000068679.1.70370 WP_000068679.1.70407 WP_000068679.1.70408 WP_000068679.1.70414 WP_000068679.1.70477 WP_000068679.1.70492 WP_000068679.1.70509 WP_000068679.1.70517 WP_000068679.1.7052 WP_000068679.1.70530 WP_000068679.1.70539 WP_000068679.1.70576 WP_000068679.1.70578 WP_000068679.1.70582 WP_000068679.1.70592 WP_000068679.1.70600 WP_000068679.1.70628 WP_000068679.1.70656 WP_000068679.1.70694 WP_000068679.1.70698 WP_000068679.1.70713 WP_000068679.1.70723 WP_000068679.1.70728 WP_000068679.1.70745 WP_000068679.1.70747 WP_000068679.1.70748 WP_000068679.1.70767 WP_000068679.1.70787 WP_000068679.1.70794 WP_000068679.1.70801 WP_000068679.1.7090 WP_000068679.1.70900 WP_000068679.1.70952 WP_000068679.1.70967 WP_000068679.1.71003 WP_000068679.1.71024 WP_000068679.1.71037 WP_000068679.1.71042 WP_000068679.1.71062 WP_000068679.1.71099 WP_000068679.1.71109 WP_000068679.1.71113 WP_000068679.1.71134 WP_000068679.1.71147 WP_000068679.1.71149 WP_000068679.1.71158 WP_000068679.1.71159 WP_000068679.1.71162 WP_000068679.1.71170 WP_000068679.1.71176 WP_000068679.1.71192 WP_000068679.1.71199 WP_000068679.1.71205 WP_000068679.1.71221 WP_000068679.1.71223 WP_000068679.1.71225 WP_000068679.1.71226 WP_000068679.1.71229 WP_000068679.1.71264 WP_000068679.1.71269 WP_000068679.1.71272 WP_000068679.1.71273 WP_000068679.1.71275 WP_000068679.1.71285 WP_000068679.1.71312 WP_000068679.1.71315 WP_000068679.1.71323 WP_000068679.1.71327 WP_000068679.1.71339 WP_000068679.1.71354 WP_000068679.1.71397 WP_000068679.1.71403 WP_000068679.1.71409 WP_000068679.1.71423 WP_000068679.1.71448 WP_000068679.1.7147 WP_000068679.1.71480 WP_000068679.1.71522 WP_000068679.1.71533 WP_000068679.1.71537 WP_000068679.1.71540 WP_000068679.1.71560 WP_000068679.1.71603 WP_000068679.1.71632 WP_000068679.1.71680 WP_000068679.1.71690 WP_000068679.1.71712 WP_000068679.1.71724 WP_000068679.1.71757 WP_000068679.1.71767 WP_000068679.1.71783 WP_000068679.1.71832 WP_000068679.1.71837 WP_000068679.1.71840 WP_000068679.1.71855 WP_000068679.1.71856 WP_000068679.1.71874 WP_000068679.1.71912 WP_000068679.1.71922 WP_000068679.1.71938 WP_000068679.1.71940 WP_000068679.1.71944 WP_000068679.1.71945 WP_000068679.1.71967 WP_000068679.1.71972 WP_000068679.1.71975 WP_000068679.1.71987 WP_000068679.1.71993 WP_000068679.1.72013 WP_000068679.1.72016 WP_000068679.1.72021 WP_000068679.1.72033 WP_000068679.1.7205 WP_000068679.1.72053 WP_000068679.1.72054 WP_000068679.1.72090 WP_000068679.1.7210 WP_000068679.1.72120 WP_000068679.1.72125 WP_000068679.1.72126 WP_000068679.1.72141 WP_000068679.1.72153 WP_000068679.1.72155 WP_000068679.1.72157 WP_000068679.1.72180 WP_000068679.1.72184 WP_000068679.1.72237 WP_000068679.1.72240 WP_000068679.1.7225 WP_000068679.1.72261 WP_000068679.1.72262 WP_000068679.1.72270 WP_000068679.1.72293 WP_000068679.1.723 WP_000068679.1.72322 WP_000068679.1.72342 WP_000068679.1.72362 WP_000068679.1.72391 WP_000068679.1.72392 WP_000068679.1.72397 WP_000068679.1.72414 WP_000068679.1.72427 WP_000068679.1.72431 WP_000068679.1.72449 WP_000068679.1.72485 WP_000068679.1.72493 WP_000068679.1.72511 WP_000068679.1.72521 WP_000068679.1.72535 WP_000068679.1.72537 WP_000068679.1.72544 WP_000068679.1.72574 WP_000068679.1.72582 WP_000068679.1.72593 WP_000068679.1.72606 WP_000068679.1.72608 WP_000068679.1.72614 WP_000068679.1.72615 WP_000068679.1.72616 WP_000068679.1.72641 WP_000068679.1.72643 WP_000068679.1.72651 WP_000068679.1.72652 WP_000068679.1.72663 WP_000068679.1.72694 WP_000068679.1.72695 WP_000068679.1.72725 WP_000068679.1.72729 WP_000068679.1.72738 WP_000068679.1.72745 WP_000068679.1.72748 WP_000068679.1.72751 WP_000068679.1.72758 WP_000068679.1.72764 WP_000068679.1.7277 WP_000068679.1.72778 WP_000068679.1.72804 WP_000068679.1.72806 WP_000068679.1.72837 WP_000068679.1.72857 WP_000068679.1.72858 WP_000068679.1.72860 WP_000068679.1.72869 WP_000068679.1.72893 WP_000068679.1.7291 WP_000068679.1.72910 WP_000068679.1.72913 WP_000068679.1.72947 WP_000068679.1.72956 WP_000068679.1.72998 WP_000068679.1.73010 WP_000068679.1.73015 WP_000068679.1.73032 WP_000068679.1.7307 WP_000068679.1.73072 WP_000068679.1.73075 WP_000068679.1.73085 WP_000068679.1.73126 WP_000068679.1.73129 WP_000068679.1.73193 WP_000068679.1.73197 WP_000068679.1.73217 WP_000068679.1.73239 WP_000068679.1.73243 WP_000068679.1.73249 WP_000068679.1.73251 WP_000068679.1.73257 WP_000068679.1.73259 WP_000068679.1.73278 WP_000068679.1.73292 WP_000068679.1.73295 WP_000068679.1.73326 WP_000068679.1.73340 WP_000068679.1.73343 WP_000068679.1.73349 WP_000068679.1.73385 WP_000068679.1.73393 WP_000068679.1.73428 WP_000068679.1.73468 WP_000068679.1.7349 WP_000068679.1.73498 WP_000068679.1.73524 WP_000068679.1.73565 WP_000068679.1.73592 WP_000068679.1.73604 WP_000068679.1.73626 WP_000068679.1.73631 WP_000068679.1.73652 WP_000068679.1.73663 WP_000068679.1.73700 WP_000068679.1.73709 WP_000068679.1.73717 WP_000068679.1.73743 WP_000068679.1.7376 WP_000068679.1.73785 WP_000068679.1.73797 WP_000068679.1.73801 WP_000068679.1.73807 WP_000068679.1.73811 WP_000068679.1.73827 WP_000068679.1.73835 WP_000068679.1.73843 WP_000068679.1.73859 WP_000068679.1.73882 WP_000068679.1.73897 WP_000068679.1.7392 WP_000068679.1.73934 WP_000068679.1.73942 WP_000068679.1.73968 WP_000068679.1.73980 WP_000068679.1.73992 WP_000068679.1.73995 WP_000068679.1.73996 WP_000068679.1.74032 WP_000068679.1.74051 WP_000068679.1.74053 WP_000068679.1.7407 WP_000068679.1.7411 WP_000068679.1.74123 WP_000068679.1.7413 WP_000068679.1.74156 WP_000068679.1.74184 WP_000068679.1.74213 WP_000068679.1.74223 WP_000068679.1.7424 WP_000068679.1.74243 WP_000068679.1.7425 WP_000068679.1.74251 WP_000068679.1.7429 WP_000068679.1.74294 WP_000068679.1.74309 WP_000068679.1.74365 WP_000068679.1.74423 WP_000068679.1.74431 WP_000068679.1.74444 WP_000068679.1.7446 WP_000068679.1.74465 WP_000068679.1.74478 WP_000068679.1.74491 WP_000068679.1.74501 WP_000068679.1.74509 WP_000068679.1.74513 WP_000068679.1.74520 WP_000068679.1.74521 WP_000068679.1.74528 WP_000068679.1.74532 WP_000068679.1.74536 WP_000068679.1.74557 WP_000068679.1.7461 WP_000068679.1.74624 WP_000068679.1.74625 WP_000068679.1.74652 WP_000068679.1.74670 WP_000068679.1.74687 WP_000068679.1.74688 WP_000068679.1.74689 WP_000068679.1.74691 WP_000068679.1.74705 WP_000068679.1.7471 WP_000068679.1.74713 WP_000068679.1.74716 WP_000068679.1.74720 WP_000068679.1.74735 WP_000068679.1.7475 WP_000068679.1.74752 WP_000068679.1.74767 WP_000068679.1.7478 WP_000068679.1.7479 WP_000068679.1.74793 WP_000068679.1.74811 WP_000068679.1.74828 WP_000068679.1.74844 WP_000068679.1.74854 WP_000068679.1.74860 WP_000068679.1.74867 WP_000068679.1.74873 WP_000068679.1.74879 WP_000068679.1.74885 WP_000068679.1.74889 WP_000068679.1.74895 WP_000068679.1.74904 WP_000068679.1.74914 WP_000068679.1.74962 WP_000068679.1.74975 WP_000068679.1.74993 WP_000068679.1.74998 WP_000068679.1.75003 WP_000068679.1.75021 WP_000068679.1.75029 WP_000068679.1.75030 WP_000068679.1.75112 WP_000068679.1.75124 WP_000068679.1.75136 WP_000068679.1.75138 WP_000068679.1.75139 WP_000068679.1.75143 WP_000068679.1.75145 WP_000068679.1.75149 WP_000068679.1.75155 WP_000068679.1.75164 WP_000068679.1.75181 WP_000068679.1.75209 WP_000068679.1.75219 WP_000068679.1.75221 WP_000068679.1.75243 WP_000068679.1.75247 WP_000068679.1.75248 WP_000068679.1.75254 WP_000068679.1.75270 WP_000068679.1.75272 WP_000068679.1.7536 WP_000068679.1.75360 WP_000068679.1.75367 WP_000068679.1.75382 WP_000068679.1.7539 WP_000068679.1.75428 WP_000068679.1.75435 WP_000068679.1.75465 WP_000068679.1.75491 WP_000068679.1.75505 WP_000068679.1.75507 WP_000068679.1.75515 WP_000068679.1.75529 WP_000068679.1.75536 WP_000068679.1.75537 WP_000068679.1.75568 WP_000068679.1.75577 WP_000068679.1.75588 WP_000068679.1.75594 WP_000068679.1.75602 WP_000068679.1.75612 WP_000068679.1.75629 WP_000068679.1.75644 WP_000068679.1.75653 WP_000068679.1.75672 WP_000068679.1.75676 WP_000068679.1.75679 WP_000068679.1.75687 WP_000068679.1.75694 WP_000068679.1.75696 WP_000068679.1.75698 WP_000068679.1.75699 WP_000068679.1.75735 WP_000068679.1.75758 WP_000068679.1.75767 WP_000068679.1.75803 WP_000068679.1.7583 WP_000068679.1.75922 WP_000068679.1.75973 WP_000068679.1.75983 WP_000068679.1.75989 WP_000068679.1.75995 WP_000068679.1.75999 WP_000068679.1.76005 WP_000068679.1.76009 WP_000068679.1.7603 WP_000068679.1.76036 WP_000068679.1.76054 WP_000068679.1.76057 WP_000068679.1.7608 WP_000068679.1.76087 WP_000068679.1.76089 WP_000068679.1.76103 WP_000068679.1.76118 WP_000068679.1.76129 WP_000068679.1.76152 WP_000068679.1.76184 WP_000068679.1.76189 WP_000068679.1.76194 WP_000068679.1.76196 WP_000068679.1.76211 WP_000068679.1.76312 WP_000068679.1.76325 WP_000068679.1.76335 WP_000068679.1.76361 WP_000068679.1.7637 WP_000068679.1.76376 WP_000068679.1.76384 WP_000068679.1.76387 WP_000068679.1.76390 WP_000068679.1.76407 WP_000068679.1.76446 WP_000068679.1.76447 WP_000068679.1.76448 WP_000068679.1.76452 WP_000068679.1.76460 WP_000068679.1.76462 WP_000068679.1.76466 WP_000068679.1.76477 WP_000068679.1.76542 WP_000068679.1.76544 WP_000068679.1.76547 WP_000068679.1.76562 WP_000068679.1.76595 WP_000068679.1.7661 WP_000068679.1.76612 WP_000068679.1.76619 WP_000068679.1.76656 WP_000068679.1.76697 WP_000068679.1.76701 WP_000068679.1.76705 WP_000068679.1.76712 WP_000068679.1.76815 WP_000068679.1.76827 WP_000068679.1.76831 WP_000068679.1.76840 WP_000068679.1.76884 WP_000068679.1.76909 WP_000068679.1.76918 WP_000068679.1.76933 WP_000068679.1.76948 WP_000068679.1.76957 WP_000068679.1.76965 WP_000068679.1.76966 WP_000068679.1.7699 WP_000068679.1.77015 WP_000068679.1.77022 WP_000068679.1.77070 WP_000068679.1.77099 WP_000068679.1.77109 WP_000068679.1.77120 WP_000068679.1.77128 WP_000068679.1.77147 WP_000068679.1.77162 WP_000068679.1.77163 WP_000068679.1.77173 WP_000068679.1.77175 WP_000068679.1.77198 WP_000068679.1.77214 WP_000068679.1.77239 WP_000068679.1.77253 WP_000068679.1.77255 WP_000068679.1.77258 WP_000068679.1.77275 WP_000068679.1.7728 WP_000068679.1.77284 WP_000068679.1.77288 WP_000068679.1.77290 WP_000068679.1.77291 WP_000068679.1.7731 WP_000068679.1.77326 WP_000068679.1.77341 WP_000068679.1.77358 WP_000068679.1.77391 WP_000068679.1.77392 WP_000068679.1.77437 WP_000068679.1.77448 WP_000068679.1.77452 WP_000068679.1.77462 WP_000068679.1.77470 WP_000068679.1.77471 WP_000068679.1.77477 WP_000068679.1.77495 WP_000068679.1.775 WP_000068679.1.77503 WP_000068679.1.77542 WP_000068679.1.77551 WP_000068679.1.77581 WP_000068679.1.77595 WP_000068679.1.77600 WP_000068679.1.77608 WP_000068679.1.77626 WP_000068679.1.77636 WP_000068679.1.77644 WP_000068679.1.77648 WP_000068679.1.77707 WP_000068679.1.77725 WP_000068679.1.77741 WP_000068679.1.77760 WP_000068679.1.77767 WP_000068679.1.77768 WP_000068679.1.7781 WP_000068679.1.77813 WP_000068679.1.77826 WP_000068679.1.77876 WP_000068679.1.77929 WP_000068679.1.77949 WP_000068679.1.7795 WP_000068679.1.77961 WP_000068679.1.77979 WP_000068679.1.7799 WP_000068679.1.77999 WP_000068679.1.78000 WP_000068679.1.78007 WP_000068679.1.78041 WP_000068679.1.78059 WP_000068679.1.7806 WP_000068679.1.78063 WP_000068679.1.7808 WP_000068679.1.78089 WP_000068679.1.78097 WP_000068679.1.78099 WP_000068679.1.78102 WP_000068679.1.78196 WP_000068679.1.78235 WP_000068679.1.78297 WP_000068679.1.78321 WP_000068679.1.78323 WP_000068679.1.78337 WP_000068679.1.78340 WP_000068679.1.78377 WP_000068679.1.78390 WP_000068679.1.784 WP_000068679.1.78413 WP_000068679.1.78445 WP_000068679.1.78481 WP_000068679.1.7851 WP_000068679.1.78515 WP_000068679.1.78527 WP_000068679.1.7855 WP_000068679.1.78553 WP_000068679.1.78581 WP_000068679.1.78583 WP_000068679.1.78586 WP_000068679.1.78593 WP_000068679.1.78610 WP_000068679.1.78611 WP_000068679.1.78612 WP_000068679.1.78615 WP_000068679.1.78645 WP_000068679.1.78683 WP_000068679.1.78687 WP_000068679.1.78696 WP_000068679.1.78698 WP_000068679.1.78718 WP_000068679.1.78746 WP_000068679.1.78750 WP_000068679.1.78757 WP_000068679.1.78775 WP_000068679.1.78791 WP_000068679.1.7883 WP_000068679.1.78843 WP_000068679.1.78854 WP_000068679.1.78888 WP_000068679.1.78891 WP_000068679.1.78919 WP_000068679.1.78953 WP_000068679.1.7896 WP_000068679.1.78966 WP_000068679.1.7898 WP_000068679.1.79001 WP_000068679.1.79002 WP_000068679.1.79004 WP_000068679.1.7901 WP_000068679.1.79065 WP_000068679.1.79067 WP_000068679.1.79075 WP_000068679.1.79086 WP_000068679.1.79088 WP_000068679.1.79090 WP_000068679.1.79092 WP_000068679.1.79172 WP_000068679.1.79226 WP_000068679.1.79246 WP_000068679.1.79306 WP_000068679.1.79308 WP_000068679.1.79312 WP_000068679.1.79343 WP_000068679.1.79346 WP_000068679.1.79356 WP_000068679.1.7937 WP_000068679.1.79391 WP_000068679.1.7940 WP_000068679.1.79409 WP_000068679.1.79416 WP_000068679.1.79464 WP_000068679.1.79478 WP_000068679.1.79505 WP_000068679.1.79519 WP_000068679.1.79525 WP_000068679.1.79526 WP_000068679.1.79528 WP_000068679.1.79540 WP_000068679.1.79558 WP_000068679.1.79563 WP_000068679.1.79576 WP_000068679.1.79591 WP_000068679.1.79606 WP_000068679.1.79685 WP_000068679.1.79713 WP_000068679.1.79715 WP_000068679.1.79764 WP_000068679.1.79800 WP_000068679.1.79816 WP_000068679.1.79824 WP_000068679.1.79840 WP_000068679.1.7985 WP_000068679.1.79869 WP_000068679.1.7987 WP_000068679.1.79871 WP_000068679.1.79877 WP_000068679.1.79905 WP_000068679.1.79922 WP_000068679.1.7993 WP_000068679.1.79930 WP_000068679.1.79931 WP_000068679.1.79932 WP_000068679.1.79936 WP_000068679.1.79944 WP_000068679.1.79965 WP_000068679.1.79984 WP_000068679.1.80011 WP_000068679.1.80043 WP_000068679.1.80050 WP_000068679.1.80060 WP_000068679.1.80061 WP_000068679.1.8007 WP_000068679.1.80071 WP_000068679.1.80106 WP_000068679.1.80112 WP_000068679.1.80136 WP_000068679.1.80141 WP_000068679.1.80176 WP_000068679.1.80183 WP_000068679.1.80192 WP_000068679.1.80255 WP_000068679.1.80292 WP_000068679.1.80309 WP_000068679.1.80310 WP_000068679.1.80320 WP_000068679.1.80330 WP_000068679.1.80388 WP_000068679.1.80426 WP_000068679.1.80428 WP_000068679.1.80440 WP_000068679.1.80444 WP_000068679.1.80456 WP_000068679.1.80463 WP_000068679.1.80484 WP_000068679.1.80517 WP_000068679.1.80519 WP_000068679.1.80545 WP_000068679.1.80558 WP_000068679.1.8057 WP_000068679.1.80578 WP_000068679.1.80594 WP_000068679.1.80606 WP_000068679.1.80626 WP_000068679.1.80662 WP_000068679.1.80666 WP_000068679.1.80676 WP_000068679.1.80709 WP_000068679.1.80731 WP_000068679.1.80736 WP_000068679.1.80737 WP_000068679.1.8074 WP_000068679.1.80753 WP_000068679.1.80754 WP_000068679.1.80756 WP_000068679.1.8076 WP_000068679.1.80768 WP_000068679.1.80789 WP_000068679.1.808 WP_000068679.1.80804 WP_000068679.1.80805 WP_000068679.1.80843 WP_000068679.1.80862 WP_000068679.1.80882 WP_000068679.1.80884 WP_000068679.1.80894 WP_000068679.1.8090 WP_000068679.1.8091 WP_000068679.1.80945 WP_000068679.1.80946 WP_000068679.1.80948 WP_000068679.1.80954 WP_000068679.1.80966 WP_000068679.1.80983 WP_000068679.1.80985 WP_000068679.1.810 WP_000068679.1.81026 WP_000068679.1.81032 WP_000068679.1.81034 WP_000068679.1.81036 WP_000068679.1.81054 WP_000068679.1.81070 WP_000068679.1.81071 WP_000068679.1.81098 WP_000068679.1.811 WP_000068679.1.81104 WP_000068679.1.81127 WP_000068679.1.81160 WP_000068679.1.81165 WP_000068679.1.81180 WP_000068679.1.81182 WP_000068679.1.8121 WP_000068679.1.81266 WP_000068679.1.81267 WP_000068679.1.81273 WP_000068679.1.81281 WP_000068679.1.81283 WP_000068679.1.8129 WP_000068679.1.81298 WP_000068679.1.81313 WP_000068679.1.81316 WP_000068679.1.81376 WP_000068679.1.81391 WP_000068679.1.81420 WP_000068679.1.81438 WP_000068679.1.81442 WP_000068679.1.81469 WP_000068679.1.81475 WP_000068679.1.81484 WP_000068679.1.81514 WP_000068679.1.81517 WP_000068679.1.8156 WP_000068679.1.81576 WP_000068679.1.81580 WP_000068679.1.81582 WP_000068679.1.81589 WP_000068679.1.81596 WP_000068679.1.81602 WP_000068679.1.81618 WP_000068679.1.81625 WP_000068679.1.81688 WP_000068679.1.81692 WP_000068679.1.8172 WP_000068679.1.81723 WP_000068679.1.81754 WP_000068679.1.81806 WP_000068679.1.81819 WP_000068679.1.81821 WP_000068679.1.81832 WP_000068679.1.81869 WP_000068679.1.81873 WP_000068679.1.81876 WP_000068679.1.81881 WP_000068679.1.81914 WP_000068679.1.81934 WP_000068679.1.81935 WP_000068679.1.81939 WP_000068679.1.81952 WP_000068679.1.81956 WP_000068679.1.81972 WP_000068679.1.81975 WP_000068679.1.82 WP_000068679.1.82010 WP_000068679.1.82032 WP_000068679.1.82057 WP_000068679.1.82059 WP_000068679.1.82061 WP_000068679.1.82062 WP_000068679.1.82074 WP_000068679.1.82116 WP_000068679.1.82137 WP_000068679.1.82217 WP_000068679.1.82221 WP_000068679.1.82239 WP_000068679.1.82240 WP_000068679.1.82242 WP_000068679.1.82246 WP_000068679.1.82275 WP_000068679.1.82280 WP_000068679.1.82296 WP_000068679.1.82316 WP_000068679.1.82320 WP_000068679.1.82326 WP_000068679.1.82330 WP_000068679.1.8235 WP_000068679.1.82378 WP_000068679.1.82438 WP_000068679.1.82439 WP_000068679.1.82485 WP_000068679.1.82499 WP_000068679.1.82507 WP_000068679.1.82527 WP_000068679.1.82572 WP_000068679.1.82594 WP_000068679.1.82614 WP_000068679.1.82626 WP_000068679.1.82629 WP_000068679.1.82647 WP_000068679.1.8268 WP_000068679.1.82682 WP_000068679.1.82691 WP_000068679.1.82700 WP_000068679.1.82705 WP_000068679.1.82711 WP_000068679.1.82715 WP_000068679.1.82718 WP_000068679.1.82754 WP_000068679.1.8277 WP_000068679.1.82780 WP_000068679.1.82797 WP_000068679.1.82799 WP_000068679.1.82820 WP_000068679.1.82831 WP_000068679.1.82853 WP_000068679.1.82902 WP_000068679.1.83020 WP_000068679.1.83033 WP_000068679.1.83035 WP_000068679.1.83051 WP_000068679.1.8306 WP_000068679.1.8308 WP_000068679.1.83093 WP_000068679.1.83097 WP_000068679.1.83099 WP_000068679.1.831 WP_000068679.1.83140 WP_000068679.1.83144 WP_000068679.1.83160 WP_000068679.1.83177 WP_000068679.1.83205 WP_000068679.1.83224 WP_000068679.1.83286 WP_000068679.1.83321 WP_000068679.1.83330 WP_000068679.1.83340 WP_000068679.1.83415 WP_000068679.1.8345 WP_000068679.1.83466 WP_000068679.1.83481 WP_000068679.1.83537 WP_000068679.1.83544 WP_000068679.1.83564 WP_000068679.1.83584 WP_000068679.1.83684 WP_000068679.1.83706 WP_000068679.1.83712 WP_000068679.1.83735 WP_000068679.1.83762 WP_000068679.1.83781 WP_000068679.1.83807 WP_000068679.1.83820 WP_000068679.1.83941 WP_000068679.1.83947 WP_000068679.1.84004 WP_000068679.1.84060 WP_000068679.1.84074 WP_000068679.1.8411 WP_000068679.1.84140 WP_000068679.1.84164 WP_000068679.1.84172 WP_000068679.1.84185 WP_000068679.1.84197 WP_000068679.1.84210 WP_000068679.1.84219 WP_000068679.1.84264 WP_000068679.1.84298 WP_000068679.1.84312 WP_000068679.1.84313 WP_000068679.1.84331 WP_000068679.1.84348 WP_000068679.1.84405 WP_000068679.1.84410 WP_000068679.1.84436 WP_000068679.1.8444 WP_000068679.1.84462 WP_000068679.1.84467 WP_000068679.1.84473 WP_000068679.1.84482 WP_000068679.1.84484 WP_000068679.1.84511 WP_000068679.1.84518 WP_000068679.1.84534 WP_000068679.1.84584 WP_000068679.1.84635 WP_000068679.1.84656 WP_000068679.1.84657 WP_000068679.1.84668 WP_000068679.1.84675 WP_000068679.1.84697 WP_000068679.1.84738 WP_000068679.1.84740 WP_000068679.1.84768 WP_000068679.1.8477 WP_000068679.1.84784 WP_000068679.1.84841 WP_000068679.1.84850 WP_000068679.1.84875 WP_000068679.1.84877 WP_000068679.1.84878 WP_000068679.1.84881 WP_000068679.1.84893 WP_000068679.1.84894 WP_000068679.1.84916 WP_000068679.1.84929 WP_000068679.1.84941 WP_000068679.1.84948 WP_000068679.1.84972 WP_000068679.1.84986 WP_000068679.1.84989 WP_000068679.1.84990 WP_000068679.1.84994 WP_000068679.1.85002 WP_000068679.1.85008 WP_000068679.1.85011 WP_000068679.1.85052 WP_000068679.1.85085 WP_000068679.1.85090 WP_000068679.1.85098 WP_000068679.1.85105 WP_000068679.1.85112 WP_000068679.1.85129 WP_000068679.1.85141 WP_000068679.1.85155 WP_000068679.1.85156 WP_000068679.1.85175 WP_000068679.1.85253 WP_000068679.1.85260 WP_000068679.1.85305 WP_000068679.1.85310 WP_000068679.1.85323 WP_000068679.1.85335 WP_000068679.1.85342 WP_000068679.1.85369 WP_000068679.1.85385 WP_000068679.1.85416 WP_000068679.1.85435 WP_000068679.1.85500 WP_000068679.1.85525 WP_000068679.1.85546 WP_000068679.1.85558 WP_000068679.1.85563 WP_000068679.1.8560 WP_000068679.1.85601 WP_000068679.1.85621 WP_000068679.1.85623 WP_000068679.1.85657 WP_000068679.1.85685 WP_000068679.1.85722 WP_000068679.1.85752 WP_000068679.1.85762 WP_000068679.1.85767 WP_000068679.1.85772 WP_000068679.1.85773 WP_000068679.1.8579 WP_000068679.1.85793 WP_000068679.1.85800 WP_000068679.1.85806 WP_000068679.1.85857 WP_000068679.1.85895 WP_000068679.1.8592 WP_000068679.1.85939 WP_000068679.1.85944 WP_000068679.1.85969 WP_000068679.1.86 WP_000068679.1.86016 WP_000068679.1.86035 WP_000068679.1.86063 WP_000068679.1.8607 WP_000068679.1.86105 WP_000068679.1.86110 WP_000068679.1.86115 WP_000068679.1.86145 WP_000068679.1.86149 WP_000068679.1.86161 WP_000068679.1.86171 WP_000068679.1.86181 WP_000068679.1.86189 WP_000068679.1.8621 WP_000068679.1.86210 WP_000068679.1.86225 WP_000068679.1.86228 WP_000068679.1.86255 WP_000068679.1.86263 WP_000068679.1.86266 WP_000068679.1.86276 WP_000068679.1.86280 WP_000068679.1.86283 WP_000068679.1.86307 WP_000068679.1.86340 WP_000068679.1.8635 WP_000068679.1.86355 WP_000068679.1.86364 WP_000068679.1.86371 WP_000068679.1.86376 WP_000068679.1.86393 WP_000068679.1.86411 WP_000068679.1.86451 WP_000068679.1.86452 WP_000068679.1.86454 WP_000068679.1.86461 WP_000068679.1.86475 WP_000068679.1.86483 WP_000068679.1.86492 WP_000068679.1.86518 WP_000068679.1.8652 WP_000068679.1.8656 WP_000068679.1.86574 WP_000068679.1.86583 WP_000068679.1.86598 WP_000068679.1.86609 WP_000068679.1.86617 WP_000068679.1.86640 WP_000068679.1.86667 WP_000068679.1.86674 WP_000068679.1.86681 WP_000068679.1.86691 WP_000068679.1.86707 WP_000068679.1.86717 WP_000068679.1.86760 WP_000068679.1.86787 WP_000068679.1.86833 WP_000068679.1.86846 WP_000068679.1.86848 WP_000068679.1.8687 WP_000068679.1.86935 WP_000068679.1.86956 WP_000068679.1.86975 WP_000068679.1.86994 WP_000068679.1.86997 WP_000068679.1.87043 WP_000068679.1.87059 WP_000068679.1.87075 WP_000068679.1.87076 WP_000068679.1.87109 WP_000068679.1.8711 WP_000068679.1.87177 WP_000068679.1.87247 WP_000068679.1.87249 WP_000068679.1.87254 WP_000068679.1.87310 WP_000068679.1.87339 WP_000068679.1.87358 WP_000068679.1.87382 WP_000068679.1.87389 WP_000068679.1.87400 WP_000068679.1.87410 WP_000068679.1.87465 WP_000068679.1.87557 WP_000068679.1.87563 WP_000068679.1.87568 WP_000068679.1.87574 WP_000068679.1.87590 WP_000068679.1.87607 WP_000068679.1.87608 WP_000068679.1.87610 WP_000068679.1.87616 WP_000068679.1.87639 WP_000068679.1.87655 WP_000068679.1.87694 WP_000068679.1.8771 WP_000068679.1.87721 WP_000068679.1.87726 WP_000068679.1.87728 WP_000068679.1.87786 WP_000068679.1.87788 WP_000068679.1.87789 WP_000068679.1.87822 WP_000068679.1.87834 WP_000068679.1.87857 WP_000068679.1.87914 WP_000068679.1.87973 WP_000068679.1.87980 WP_000068679.1.87984 WP_000068679.1.87989 WP_000068679.1.880 WP_000068679.1.88017 WP_000068679.1.88020 WP_000068679.1.88066 WP_000068679.1.88088 WP_000068679.1.88110 WP_000068679.1.88155 WP_000068679.1.88189 WP_000068679.1.88197 WP_000068679.1.88238 WP_000068679.1.88252 WP_000068679.1.88285 WP_000068679.1.88304 WP_000068679.1.88352 WP_000068679.1.88376 WP_000068679.1.88379 WP_000068679.1.88384 WP_000068679.1.88413 WP_000068679.1.88427 WP_000068679.1.8843 WP_000068679.1.88434 WP_000068679.1.88438 WP_000068679.1.88462 WP_000068679.1.88467 WP_000068679.1.88524 WP_000068679.1.88528 WP_000068679.1.88535 WP_000068679.1.88539 WP_000068679.1.8854 WP_000068679.1.88557 WP_000068679.1.88577 WP_000068679.1.88598 WP_000068679.1.88603 WP_000068679.1.88607 WP_000068679.1.88631 WP_000068679.1.88646 WP_000068679.1.88667 WP_000068679.1.88678 WP_000068679.1.88685 WP_000068679.1.88709 WP_000068679.1.88710 WP_000068679.1.88711 WP_000068679.1.88720 WP_000068679.1.88729 WP_000068679.1.88732 WP_000068679.1.88735 WP_000068679.1.88757 WP_000068679.1.88759 WP_000068679.1.88767 WP_000068679.1.8879 WP_000068679.1.88803 WP_000068679.1.88834 WP_000068679.1.88864 WP_000068679.1.88891 WP_000068679.1.88950 WP_000068679.1.88961 WP_000068679.1.88997 WP_000068679.1.89018 WP_000068679.1.89050 WP_000068679.1.8906 WP_000068679.1.89067 WP_000068679.1.89090 WP_000068679.1.89097 WP_000068679.1.89099 WP_000068679.1.89111 WP_000068679.1.89165 WP_000068679.1.89183 WP_000068679.1.89197 WP_000068679.1.89200 WP_000068679.1.89255 WP_000068679.1.8928 WP_000068679.1.89305 WP_000068679.1.89322 WP_000068679.1.89335 WP_000068679.1.8938 WP_000068679.1.89385 WP_000068679.1.894 WP_000068679.1.89400 WP_000068679.1.89403 WP_000068679.1.89405 WP_000068679.1.89416 WP_000068679.1.89432 WP_000068679.1.8945 WP_000068679.1.89458 WP_000068679.1.89468 WP_000068679.1.89471 WP_000068679.1.89474 WP_000068679.1.89479 WP_000068679.1.89492 WP_000068679.1.89510 WP_000068679.1.89569 WP_000068679.1.89601 WP_000068679.1.89605 WP_000068679.1.89630 WP_000068679.1.89646 WP_000068679.1.89656 WP_000068679.1.89674 WP_000068679.1.89679 WP_000068679.1.89700 WP_000068679.1.89768 WP_000068679.1.89781 WP_000068679.1.89788 WP_000068679.1.89818 WP_000068679.1.89839 WP_000068679.1.89841 WP_000068679.1.89852 WP_000068679.1.89859 WP_000068679.1.89879 WP_000068679.1.89895 WP_000068679.1.89899 WP_000068679.1.89915 WP_000068679.1.89918 WP_000068679.1.89920 WP_000068679.1.89923 WP_000068679.1.89925 WP_000068679.1.89927 WP_000068679.1.89959 WP_000068679.1.89977 WP_000068679.1.89988 WP_000068679.1.89998 WP_000068679.1.90017 WP_000068679.1.90063 WP_000068679.1.90065 WP_000068679.1.90078 WP_000068679.1.9009 WP_000068679.1.9010 WP_000068679.1.90115 WP_000068679.1.90128 WP_000068679.1.90139 WP_000068679.1.90146 WP_000068679.1.90156 WP_000068679.1.90168 WP_000068679.1.90182 WP_000068679.1.90205 WP_000068679.1.90219 WP_000068679.1.90249 WP_000068679.1.90256 WP_000068679.1.90257 WP_000068679.1.90266 WP_000068679.1.90270 WP_000068679.1.90314 WP_000068679.1.90332 WP_000068679.1.90342 WP_000068679.1.90349 WP_000068679.1.9036 WP_000068679.1.90389 WP_000068679.1.90405 WP_000068679.1.90435 WP_000068679.1.90436 WP_000068679.1.90441 WP_000068679.1.90449 WP_000068679.1.90511 WP_000068679.1.90520 WP_000068679.1.90536 WP_000068679.1.90547 WP_000068679.1.9059 WP_000068679.1.90591 WP_000068679.1.9061 WP_000068679.1.90626 WP_000068679.1.90703 WP_000068679.1.90706 WP_000068679.1.90758 WP_000068679.1.90799 WP_000068679.1.9081 WP_000068679.1.90813 WP_000068679.1.90828 WP_000068679.1.90834 WP_000068679.1.90837 WP_000068679.1.90839 WP_000068679.1.9084 WP_000068679.1.90848 WP_000068679.1.90856 WP_000068679.1.90864 WP_000068679.1.90865 WP_000068679.1.90873 WP_000068679.1.90890 WP_000068679.1.90924 WP_000068679.1.90951 WP_000068679.1.90967 WP_000068679.1.90979 WP_000068679.1.9098 WP_000068679.1.90996 WP_000068679.1.90997 WP_000068679.1.91 WP_000068679.1.91018 WP_000068679.1.91072 WP_000068679.1.91088 WP_000068679.1.91094 WP_000068679.1.91113 WP_000068679.1.91117 WP_000068679.1.91121 WP_000068679.1.91138 WP_000068679.1.91153 WP_000068679.1.91170 WP_000068679.1.9118 WP_000068679.1.91266 WP_000068679.1.91268 WP_000068679.1.91277 WP_000068679.1.91288 WP_000068679.1.91290 WP_000068679.1.91340 WP_000068679.1.91341 WP_000068679.1.91356 WP_000068679.1.91384 WP_000068679.1.91397 WP_000068679.1.91414 WP_000068679.1.91445 WP_000068679.1.91462 WP_000068679.1.91485 WP_000068679.1.915 WP_000068679.1.91511 WP_000068679.1.91516 WP_000068679.1.91526 WP_000068679.1.91548 WP_000068679.1.91551 WP_000068679.1.91565 WP_000068679.1.9157 WP_000068679.1.91594 WP_000068679.1.91596 WP_000068679.1.9160 WP_000068679.1.91630 WP_000068679.1.91640 WP_000068679.1.91643 WP_000068679.1.91644 WP_000068679.1.91651 WP_000068679.1.91672 WP_000068679.1.9168 WP_000068679.1.91685 WP_000068679.1.9169 WP_000068679.1.91701 WP_000068679.1.9171 WP_000068679.1.91739 WP_000068679.1.91777 WP_000068679.1.91779 WP_000068679.1.91782 WP_000068679.1.91787 WP_000068679.1.91793 WP_000068679.1.91801 WP_000068679.1.9185 WP_000068679.1.91850 WP_000068679.1.91863 WP_000068679.1.91871 WP_000068679.1.91879 WP_000068679.1.91887 WP_000068679.1.91951 WP_000068679.1.91959 WP_000068679.1.91971 WP_000068679.1.92005 WP_000068679.1.92014 WP_000068679.1.92019 WP_000068679.1.92029 WP_000068679.1.92031 WP_000068679.1.92048 WP_000068679.1.92058 WP_000068679.1.921 WP_000068679.1.92102 WP_000068679.1.92114 WP_000068679.1.92123 WP_000068679.1.92161 WP_000068679.1.92163 WP_000068679.1.92180 WP_000068679.1.92195 WP_000068679.1.92215 WP_000068679.1.92224 WP_000068679.1.92304 WP_000068679.1.92311 WP_000068679.1.92323 WP_000068679.1.92361 WP_000068679.1.924 WP_000068679.1.92434 WP_000068679.1.92462 WP_000068679.1.92495 WP_000068679.1.92496 WP_000068679.1.92506 WP_000068679.1.92532 WP_000068679.1.92535 WP_000068679.1.9255 WP_000068679.1.92568 WP_000068679.1.92571 WP_000068679.1.92577 WP_000068679.1.92614 WP_000068679.1.92615 WP_000068679.1.92634 WP_000068679.1.9264 WP_000068679.1.9266 WP_000068679.1.92668 WP_000068679.1.92708 WP_000068679.1.92719 WP_000068679.1.92742 WP_000068679.1.92750 WP_000068679.1.92780 WP_000068679.1.92781 WP_000068679.1.92792 WP_000068679.1.92793 WP_000068679.1.92796 WP_000068679.1.92819 WP_000068679.1.92845 WP_000068679.1.92865 WP_000068679.1.92932 WP_000068679.1.92943 WP_000068679.1.92953 WP_000068679.1.92989 WP_000068679.1.92991 WP_000068679.1.93005 WP_000068679.1.93016 WP_000068679.1.93019 WP_000068679.1.93023 WP_000068679.1.93027 WP_000068679.1.93033 WP_000068679.1.93048 WP_000068679.1.93052 WP_000068679.1.93054 WP_000068679.1.93069 WP_000068679.1.93072 WP_000068679.1.93085 WP_000068679.1.93100 WP_000068679.1.93133 WP_000068679.1.93150 WP_000068679.1.93175 WP_000068679.1.93252 WP_000068679.1.93267 WP_000068679.1.93276 WP_000068679.1.93291 WP_000068679.1.93309 WP_000068679.1.93312 WP_000068679.1.93338 WP_000068679.1.93379 WP_000068679.1.93388 WP_000068679.1.93427 WP_000068679.1.93428 WP_000068679.1.93463 WP_000068679.1.93468 WP_000068679.1.93509 WP_000068679.1.93531 WP_000068679.1.93569 WP_000068679.1.93601 WP_000068679.1.93605 WP_000068679.1.93621 WP_000068679.1.93626 WP_000068679.1.93630 WP_000068679.1.93634 WP_000068679.1.93637 WP_000068679.1.93652 WP_000068679.1.93665 WP_000068679.1.93670 WP_000068679.1.93673 WP_000068679.1.93695 WP_000068679.1.93733 WP_000068679.1.93742 WP_000068679.1.93743 WP_000068679.1.93745 WP_000068679.1.93755 WP_000068679.1.93768 WP_000068679.1.938 WP_000068679.1.93800 WP_000068679.1.93821 WP_000068679.1.93873 WP_000068679.1.93877 WP_000068679.1.939 WP_000068679.1.93900 WP_000068679.1.93911 WP_000068679.1.93918 WP_000068679.1.93921 WP_000068679.1.93951 WP_000068679.1.93971 WP_000068679.1.94008 WP_000068679.1.94011 WP_000068679.1.94025 WP_000068679.1.94156 WP_000068679.1.9416 WP_000068679.1.94176 WP_000068679.1.94187 WP_000068679.1.94190 WP_000068679.1.94213 WP_000068679.1.94232 WP_000068679.1.9426 WP_000068679.1.94271 WP_000068679.1.94282 WP_000068679.1.94298 WP_000068679.1.94302 WP_000068679.1.94317 WP_000068679.1.94343 WP_000068679.1.94353 WP_000068679.1.94367 WP_000068679.1.94388 WP_000068679.1.94404 WP_000068679.1.94429 WP_000068679.1.94446 WP_000068679.1.94468 WP_000068679.1.94475 WP_000068679.1.94497 WP_000068679.1.94507 WP_000068679.1.94516 WP_000068679.1.94523 WP_000068679.1.94542 WP_000068679.1.94544 WP_000068679.1.94548 WP_000068679.1.9457 WP_000068679.1.94578 WP_000068679.1.94580 WP_000068679.1.94589 WP_000068679.1.94626 WP_000068679.1.94646 WP_000068679.1.94676 WP_000068679.1.94690 WP_000068679.1.94692 WP_000068679.1.94695 WP_000068679.1.94704 WP_000068679.1.94738 WP_000068679.1.9474 WP_000068679.1.94753 WP_000068679.1.94754 WP_000068679.1.94764 WP_000068679.1.94787 WP_000068679.1.94790 WP_000068679.1.948 WP_000068679.1.94801 WP_000068679.1.94806 WP_000068679.1.94808 WP_000068679.1.94822 WP_000068679.1.94836 WP_000068679.1.94877 WP_000068679.1.94880 WP_000068679.1.94889 WP_000068679.1.94898 WP_000068679.1.949 WP_000068679.1.94903 WP_000068679.1.9491 WP_000068679.1.94935 WP_000068679.1.94949 WP_000068679.1.94963 WP_000068679.1.94991 WP_000068679.1.94993 WP_000068679.1.95005 WP_000068679.1.95011 WP_000068679.1.95022 WP_000068679.1.95028 WP_000068679.1.95035 WP_000068679.1.95036 WP_000068679.1.95037 WP_000068679.1.95129 WP_000068679.1.9513 WP_000068679.1.95161 WP_000068679.1.95198 WP_000068679.1.95233 WP_000068679.1.95243 WP_000068679.1.95332 WP_000068679.1.95368 WP_000068679.1.95381 WP_000068679.1.95390 WP_000068679.1.95395 WP_000068679.1.95400 WP_000068679.1.95403 WP_000068679.1.95424 WP_000068679.1.95431 WP_000068679.1.95438 WP_000068679.1.95490 WP_000068679.1.95518 WP_000068679.1.95563 WP_000068679.1.9559 WP_000068679.1.95595 WP_000068679.1.95596 WP_000068679.1.95604 WP_000068679.1.95611 WP_000068679.1.95634 WP_000068679.1.95655 WP_000068679.1.95712 WP_000068679.1.95756 WP_000068679.1.95759 WP_000068679.1.95771 WP_000068679.1.95800 WP_000068679.1.95801 WP_000068679.1.95821 WP_000068679.1.95824 WP_000068679.1.95827 WP_000068679.1.95834 WP_000068679.1.95835 WP_000068679.1.95849 WP_000068679.1.95861 WP_000068679.1.95865 WP_000068679.1.95869 WP_000068679.1.95916 WP_000068679.1.95919 WP_000068679.1.95931 WP_000068679.1.95932 WP_000068679.1.960 WP_000068679.1.96015 WP_000068679.1.96032 WP_000068679.1.96053 WP_000068679.1.96066 WP_000068679.1.96086 WP_000068679.1.96097 WP_000068679.1.96114 WP_000068679.1.96128 WP_000068679.1.9616 WP_000068679.1.96177 WP_000068679.1.96215 WP_000068679.1.96222 WP_000068679.1.96229 WP_000068679.1.96247 WP_000068679.1.96278 WP_000068679.1.96279 WP_000068679.1.96281 WP_000068679.1.96290 WP_000068679.1.96293 WP_000068679.1.96299 WP_000068679.1.9631 WP_000068679.1.96339 WP_000068679.1.96341 WP_000068679.1.96394 WP_000068679.1.96417 WP_000068679.1.96420 WP_000068679.1.96425 WP_000068679.1.96450 WP_000068679.1.96457 WP_000068679.1.96479 WP_000068679.1.96480 WP_000068679.1.96484 WP_000068679.1.96494 WP_000068679.1.965 WP_000068679.1.96541 WP_000068679.1.96562 WP_000068679.1.9657 WP_000068679.1.96585 WP_000068679.1.96608 WP_000068679.1.96609 WP_000068679.1.9661 WP_000068679.1.96680 WP_000068679.1.96683 WP_000068679.1.96701 WP_000068679.1.96725 WP_000068679.1.96743 WP_000068679.1.96753 WP_000068679.1.96769 WP_000068679.1.96779 WP_000068679.1.96796 WP_000068679.1.96817 WP_000068679.1.96850 WP_000068679.1.9690 WP_000068679.1.9691 WP_000068679.1.96924 WP_000068679.1.96932 WP_000068679.1.96936 WP_000068679.1.96944 WP_000068679.1.96989 WP_000068679.1.97011 WP_000068679.1.97027 WP_000068679.1.97049 WP_000068679.1.97059 WP_000068679.1.9708 WP_000068679.1.97119 WP_000068679.1.97123 WP_000068679.1.97193 WP_000068679.1.97195 WP_000068679.1.97200 WP_000068679.1.97231 WP_000068679.1.97238 WP_000068679.1.97248 WP_000068679.1.97279 WP_000068679.1.9729 WP_000068679.1.97344 WP_000068679.1.97356 WP_000068679.1.97360 WP_000068679.1.97361 WP_000068679.1.9740 WP_000068679.1.97402 WP_000068679.1.97418 WP_000068679.1.97421 WP_000068679.1.97434 WP_000068679.1.97439 WP_000068679.1.97459 WP_000068679.1.9747 WP_000068679.1.97490 WP_000068679.1.97502 WP_000068679.1.97513 WP_000068679.1.97525 WP_000068679.1.97527 WP_000068679.1.97544 WP_000068679.1.97560 WP_000068679.1.97632 WP_000068679.1.97667 WP_000068679.1.97675 WP_000068679.1.97677 WP_000068679.1.97685 WP_000068679.1.9770 WP_000068679.1.97705 WP_000068679.1.97711 WP_000068679.1.97775 WP_000068679.1.97778 WP_000068679.1.97789 WP_000068679.1.97798 WP_000068679.1.97802 WP_000068679.1.97815 WP_000068679.1.97822 WP_000068679.1.97825 WP_000068679.1.97871 WP_000068679.1.97895 WP_000068679.1.97930 WP_000068679.1.97932 WP_000068679.1.97937 WP_000068679.1.97962 WP_000068679.1.97982 WP_000068679.1.97996 WP_000068679.1.98012 WP_000068679.1.98026 WP_000068679.1.9803 WP_000068679.1.98046 WP_000068679.1.98082 WP_000068679.1.98083 WP_000068679.1.981 WP_000068679.1.98115 WP_000068679.1.98139 WP_000068679.1.98155 WP_000068679.1.9816 WP_000068679.1.9817 WP_000068679.1.98176 WP_000068679.1.98187 WP_000068679.1.98205 WP_000068679.1.98208 WP_000068679.1.98220 WP_000068679.1.98232 WP_000068679.1.98235 WP_000068679.1.98239 WP_000068679.1.98241 WP_000068679.1.98244 WP_000068679.1.98279 WP_000068679.1.98284 WP_000068679.1.98292 WP_000068679.1.98294 WP_000068679.1.98301 WP_000068679.1.98312 WP_000068679.1.98323 WP_000068679.1.98355 WP_000068679.1.98357 WP_000068679.1.98384 WP_000068679.1.98400 WP_000068679.1.98424 WP_000068679.1.98442 WP_000068679.1.98451 WP_000068679.1.98477 WP_000068679.1.98498 WP_000068679.1.98543 WP_000068679.1.98549 WP_000068679.1.98569 WP_000068679.1.98578 WP_000068679.1.9858 WP_000068679.1.98587 WP_000068679.1.98603 WP_000068679.1.98614 WP_000068679.1.98628 WP_000068679.1.9864 WP_000068679.1.98641 WP_000068679.1.98654 WP_000068679.1.98665 WP_000068679.1.98668 WP_000068679.1.98683 WP_000068679.1.98702 WP_000068679.1.98775 WP_000068679.1.98776 WP_000068679.1.98795 WP_000068679.1.9883 WP_000068679.1.98849 WP_000068679.1.98875 WP_000068679.1.98886 WP_000068679.1.98908 WP_000068679.1.98920 WP_000068679.1.98976 WP_000068679.1.98988 WP_000068679.1.99029 WP_000068679.1.99046 WP_000068679.1.99053 WP_000068679.1.99060 WP_000068679.1.9907 WP_000068679.1.99101 WP_000068679.1.99110 WP_000068679.1.99119 WP_000068679.1.99168 WP_000068679.1.99182 WP_000068679.1.99209 WP_000068679.1.99234 WP_000068679.1.99246 WP_000068679.1.99265 WP_000068679.1.99289 WP_000068679.1.99292 WP_000068679.1.99295 WP_000068679.1.99302 WP_000068679.1.99304 WP_000068679.1.99310 WP_000068679.1.99319 WP_000068679.1.99334 WP_000068679.1.99345 WP_000068679.1.99349 WP_000068679.1.99361 WP_000068679.1.99392 WP_000068679.1.9940 WP_000068679.1.99400 WP_000068679.1.99427 WP_000068679.1.99446 WP_000068679.1.99453 WP_000068679.1.99475 WP_000068679.1.99486 WP_000068679.1.99487 WP_000068679.1.9950 WP_000068679.1.99501 WP_000068679.1.99511 WP_000068679.1.99534 WP_000068679.1.99562 WP_000068679.1.99592 WP_000068679.1.99602 WP_000068679.1.99619 WP_000068679.1.99632 WP_000068679.1.99641 WP_000068679.1.99666 WP_000068679.1.99692 WP_000068679.1.99774 WP_000068679.1.99791 WP_000068679.1.99804 WP_000068679.1.99827 WP_000068679.1.99869 WP_000068679.1.99912 WP_000068679.1.99929 WP_000068679.1.99986 YP_006780980.1.12065 YP_405994.1.10455 gi|471335773|ref|YP_007559250.1| gi|387624023|ref|YP_006131651.1| 3wrpA gi|407483831|ref|YP_006780980.1| gi|24115622|ref|NP_710132.1| gi|387624023|ref|YP_006131651.1| gi|238903480|ref|YP_002929276.1| gi|82779645|ref|YP_405994.1| gi|170083779|ref|YP_001733099.1| gi|560160852|ref|YP_008853567.1| gi|387885588|ref|YP_006315890.1| gi|443616010|ref|YP_007379866.1| gi|260858567|ref|YP_003232458.1| gi|157163841|ref|YP_001461159.1| gi|386617271|ref|YP_006136938.1| gi|387509837|ref|YP_006162093.1| gi|218556928|ref|YP_002389842.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]