SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407462088|ref|YP_006773405.1| from Candidatus Nitrosoarchaeum koreensis Candidatus Nitrosopumilus koreensis AR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407462088|ref|YP_006773405.1|
Domain Number 1 Region: 23-168
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.14e-18
Family GHMP Kinase, N-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 196-272
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.0000216
Family Homoserine kinase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407462088|ref|YP_006773405.1|
Sequence length 284
Comment shikimate kinase [Candidatus Nitrosopumilus koreensis AR1]
Sequence
MAKVKATVHGAVSLVNAIANQKGATLGIDLKVEATIETSPGKGIVIQSENKTLSSRLINK
TVEKIVSKKDLEQNKITITLESEIPTGYGLKSSSAISSAVALGCAKIFKPKFTDKQILLA
GVDASIESKVSITGAYDDACSCYYGGFNVTDNAKKKRISHEKGPSNLIAVIFIPKNRKRG
NLKKLKVLSSVFDHAWNLARKTNYWEAMIINGLATASILSSSPEIITELIERGSLGASVS
GNGPAIAAITKKENESNIKKAFSALEGNIIISKISNKKAEVHEV
Download sequence
Identical sequences K0B351
gi|407462088|ref|YP_006773405.1| WP_014962852.1.70052 WP_014962852.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]