SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407463428|ref|YP_006774745.1| from Candidatus Nitrosoarchaeum koreensis Candidatus Nitrosopumilus koreensis AR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407463428|ref|YP_006774745.1|
Domain Number 1 Region: 4-161
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.35e-34
Family GHMP Kinase, N-terminal domain 0.000021
Further Details:      
 
Domain Number 2 Region: 165-284
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.08e-23
Family Homoserine kinase 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407463428|ref|YP_006774745.1|
Sequence length 307
Comment homoserine kinase [Candidatus Nitrosopumilus koreensis AR1]
Sequence
MVSKITVKAPSSTANLGPGFDVFGLAIDAFYDEVTLTKTKSGITIVTDDNIPTEPQNNTA
GLVVQNMKKKFKIKSGVEIKIKKGVPAGFGMGSSAASAAATAVAFDKLFELKLDGNSLVE
FAGSGEKASAGSVHYDNVAASVLGGFVIVKTNPLQVIRIDPPTNLRMCVAVPKLDVPKKK
TKVSRGVIPKKIKLTDSILNLSNASAIVAGFMKKDPNLIGNSIKDVIVEPARQHMIPGFS
KVKQNALKAGALGVTISGAGPSVIAFSKSSANLKKISSAMSKGFTSANTKCQTVICKPSK
GAADKRK
Download sequence
Identical sequences K0B6Q5
gi|407463428|ref|YP_006774745.1| WP_014964176.1.70052 WP_014964176.1.82955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]