SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194098563|ref|YP_002001625.1| from Neisseria gonorrhoeae NCCP11945

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194098563|ref|YP_002001625.1|
Domain Number 1 Region: 26-228
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.14e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.000000159
Further Details:      
 
Domain Number 2 Region: 312-444
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.09e-31
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000109
Further Details:      
 
Domain Number 3 Region: 230-306
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.71e-18
Family Duplicated SiR/NiR-like domains 1 and 3 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|194098563|ref|YP_002001625.1|
Sequence length 465
Comment putative sulfite reductase subunit beta [Neisseria gonorrhoeae NCCP11945]
Sequence
MPKTKLQTMPRLLHSLGLDSIATAADMNRNVLCTSNPIESELHRQAYEYAKKISEHLLPR
TRGYLDMWVDGKKVQSSDDFLQEGEPILGKTYLPRKFKTAVVIPPLNDVDCYGNDLDFVA
VSDGNGQLAGFNVLAGGGLSTEHGNGNTKTYPNISLELGFVPPEHALKAAEAVVTTQRNF
GNRSHRKNDRTRYTIQNMGLDNFRTEVERRMGMPFKPIRPFKFTGRGDRIGRVKGIDGNW
HLTLFIESGRLVDEGGKQLLTGVLEIAKIHKGGFRITANQNLIVANVPEGGKARIEQLAR
SYGLIRDGVSKLRENAMSCASFPTCPLAMAEAERVLPDFIGELDKIMAEHGASDDYIVTR
ITGCPNGCGRAMLAEIGLVGKAVGRYNLHIGGDREGVRIPRLYKENITLPEILSELEDLI
GKWAAGRDTDEGFGDFAIRTGIVKPVLDAPVDFWDASKAVPIARA
Download sequence
Identical sequences B4RLJ0
521006.NGK_1000 gi|194098563|ref|YP_002001625.1| gi|385335693|ref|YP_005889640.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]