SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194097869|ref|YP_002000914.1| from Neisseria gonorrhoeae NCCP11945

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194097869|ref|YP_002000914.1|
Domain Number 1 Region: 94-235
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.02e-22
Family GntR ligand-binding domain-like 0.0076
Further Details:      
 
Domain Number 2 Region: 28-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000409
Family GntR-like transcriptional regulators 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|194097869|ref|YP_002000914.1|
Sequence length 238
Comment GntR family transcriptional regulator [Neisseria gonorrhoeae NCCP11945]
Sequence
MNFENDDIIHAPTTSSLILEERHDSELFRVYALILDGITDQVLLPGKKLTESELCRQMVC
SRNTVRGALSLLAHDKIVDLQPNRGAFVHVPDLKEMQDVFNARIEMETMILNILAGLPDL
ETRLKPLYAMIRCEEEASGRGDRVGWNRLSNAFHVELARLVGNDVLFDIMNTLCARSSLI
VAVAGVHREKKHAINTHTHSEHREILDLLLAGRRNRVVKILRRHLGNCMERLEKTLED
Download sequence
Identical sequences A0A0M3GVY2 A0A1D3HPD2 B4RJ28 D6HBF0 Q5F7F7
WP_003689664.1.100340 WP_003689664.1.100478 WP_003689664.1.100556 WP_003689664.1.100674 WP_003689664.1.100774 WP_003689664.1.101026 WP_003689664.1.10157 WP_003689664.1.101626 WP_003689664.1.101960 WP_003689664.1.102080 WP_003689664.1.10719 WP_003689664.1.11196 WP_003689664.1.11215 WP_003689664.1.11432 WP_003689664.1.11593 WP_003689664.1.11598 WP_003689664.1.11605 WP_003689664.1.11648 WP_003689664.1.11780 WP_003689664.1.118 WP_003689664.1.12269 WP_003689664.1.12401 WP_003689664.1.12408 WP_003689664.1.12969 WP_003689664.1.13128 WP_003689664.1.13586 WP_003689664.1.13808 WP_003689664.1.13918 WP_003689664.1.13996 WP_003689664.1.14055 WP_003689664.1.14086 WP_003689664.1.14503 WP_003689664.1.14572 WP_003689664.1.14702 WP_003689664.1.14736 WP_003689664.1.14867 WP_003689664.1.15092 WP_003689664.1.1519 WP_003689664.1.15404 WP_003689664.1.15472 WP_003689664.1.15676 WP_003689664.1.15794 WP_003689664.1.15929 WP_003689664.1.16216 WP_003689664.1.16445 WP_003689664.1.16513 WP_003689664.1.16720 WP_003689664.1.16907 WP_003689664.1.17281 WP_003689664.1.17358 WP_003689664.1.17452 WP_003689664.1.17491 WP_003689664.1.17557 WP_003689664.1.17669 WP_003689664.1.17997 WP_003689664.1.18004 WP_003689664.1.18213 WP_003689664.1.18612 WP_003689664.1.18855 WP_003689664.1.19099 WP_003689664.1.19309 WP_003689664.1.19316 WP_003689664.1.19563 WP_003689664.1.19598 WP_003689664.1.19652 WP_003689664.1.19712 WP_003689664.1.2032 WP_003689664.1.21065 WP_003689664.1.21221 WP_003689664.1.21622 WP_003689664.1.21626 WP_003689664.1.21844 WP_003689664.1.22742 WP_003689664.1.22912 WP_003689664.1.23029 WP_003689664.1.23186 WP_003689664.1.23479 WP_003689664.1.23608 WP_003689664.1.23780 WP_003689664.1.24180 WP_003689664.1.24360 WP_003689664.1.24534 WP_003689664.1.2468 WP_003689664.1.24807 WP_003689664.1.2484 WP_003689664.1.24967 WP_003689664.1.25223 WP_003689664.1.25464 WP_003689664.1.25530 WP_003689664.1.25790 WP_003689664.1.25859 WP_003689664.1.25878 WP_003689664.1.25919 WP_003689664.1.25936 WP_003689664.1.25989 WP_003689664.1.26035 WP_003689664.1.26211 WP_003689664.1.26393 WP_003689664.1.26568 WP_003689664.1.2711 WP_003689664.1.27438 WP_003689664.1.28332 WP_003689664.1.28539 WP_003689664.1.28664 WP_003689664.1.28797 WP_003689664.1.29027 WP_003689664.1.29241 WP_003689664.1.29678 WP_003689664.1.29690 WP_003689664.1.30002 WP_003689664.1.30685 WP_003689664.1.30922 WP_003689664.1.31843 WP_003689664.1.32564 WP_003689664.1.32778 WP_003689664.1.33058 WP_003689664.1.33375 WP_003689664.1.33605 WP_003689664.1.33857 WP_003689664.1.33955 WP_003689664.1.3414 WP_003689664.1.34186 WP_003689664.1.34493 WP_003689664.1.35650 WP_003689664.1.35766 WP_003689664.1.35838 WP_003689664.1.359 WP_003689664.1.36743 WP_003689664.1.3679 WP_003689664.1.36815 WP_003689664.1.37129 WP_003689664.1.37162 WP_003689664.1.37499 WP_003689664.1.37682 WP_003689664.1.37920 WP_003689664.1.37958 WP_003689664.1.38116 WP_003689664.1.3854 WP_003689664.1.38592 WP_003689664.1.3868 WP_003689664.1.38959 WP_003689664.1.39024 WP_003689664.1.39077 WP_003689664.1.393 WP_003689664.1.39303 WP_003689664.1.39487 WP_003689664.1.3952 WP_003689664.1.39627 WP_003689664.1.39755 WP_003689664.1.3985 WP_003689664.1.40035 WP_003689664.1.40104 WP_003689664.1.40772 WP_003689664.1.41577 WP_003689664.1.42224 WP_003689664.1.42307 WP_003689664.1.42894 WP_003689664.1.42901 WP_003689664.1.43153 WP_003689664.1.43189 WP_003689664.1.43348 WP_003689664.1.4339 WP_003689664.1.43541 WP_003689664.1.43586 WP_003689664.1.43854 WP_003689664.1.4448 WP_003689664.1.44621 WP_003689664.1.4497 WP_003689664.1.45509 WP_003689664.1.45630 WP_003689664.1.45863 WP_003689664.1.46190 WP_003689664.1.46428 WP_003689664.1.46903 WP_003689664.1.47393 WP_003689664.1.47474 WP_003689664.1.47826 WP_003689664.1.47844 WP_003689664.1.48058 WP_003689664.1.48286 WP_003689664.1.48369 WP_003689664.1.48644 WP_003689664.1.49022 WP_003689664.1.49068 WP_003689664.1.49284 WP_003689664.1.49608 WP_003689664.1.49665 WP_003689664.1.49694 WP_003689664.1.50069 WP_003689664.1.50074 WP_003689664.1.50197 WP_003689664.1.50678 WP_003689664.1.51699 WP_003689664.1.52063 WP_003689664.1.52104 WP_003689664.1.52237 WP_003689664.1.52948 WP_003689664.1.53130 WP_003689664.1.53298 WP_003689664.1.53438 WP_003689664.1.536 WP_003689664.1.53779 WP_003689664.1.53832 WP_003689664.1.53860 WP_003689664.1.54122 WP_003689664.1.54174 WP_003689664.1.54389 WP_003689664.1.54642 WP_003689664.1.54659 WP_003689664.1.55124 WP_003689664.1.55159 WP_003689664.1.55406 WP_003689664.1.5594 WP_003689664.1.55987 WP_003689664.1.56090 WP_003689664.1.56109 WP_003689664.1.56168 WP_003689664.1.56256 WP_003689664.1.56686 WP_003689664.1.56813 WP_003689664.1.57030 WP_003689664.1.57062 WP_003689664.1.57372 WP_003689664.1.57375 WP_003689664.1.57388 WP_003689664.1.57695 WP_003689664.1.57697 WP_003689664.1.57901 WP_003689664.1.57984 WP_003689664.1.58235 WP_003689664.1.58285 WP_003689664.1.58880 WP_003689664.1.58971 WP_003689664.1.59161 WP_003689664.1.59182 WP_003689664.1.59728 WP_003689664.1.59792 WP_003689664.1.60234 WP_003689664.1.60358 WP_003689664.1.60565 WP_003689664.1.6084 WP_003689664.1.60906 WP_003689664.1.61526 WP_003689664.1.61701 WP_003689664.1.62467 WP_003689664.1.62499 WP_003689664.1.64272 WP_003689664.1.64284 WP_003689664.1.64344 WP_003689664.1.64652 WP_003689664.1.64843 WP_003689664.1.65089 WP_003689664.1.65891 WP_003689664.1.66113 WP_003689664.1.66283 WP_003689664.1.66353 WP_003689664.1.66920 WP_003689664.1.66927 WP_003689664.1.67738 WP_003689664.1.68023 WP_003689664.1.68047 WP_003689664.1.68082 WP_003689664.1.68298 WP_003689664.1.68634 WP_003689664.1.68663 WP_003689664.1.68720 WP_003689664.1.68771 WP_003689664.1.68907 WP_003689664.1.68996 WP_003689664.1.69030 WP_003689664.1.69067 WP_003689664.1.69334 WP_003689664.1.69555 WP_003689664.1.70265 WP_003689664.1.70552 WP_003689664.1.70616 WP_003689664.1.71019 WP_003689664.1.71233 WP_003689664.1.71321 WP_003689664.1.71411 WP_003689664.1.71646 WP_003689664.1.71766 WP_003689664.1.72029 WP_003689664.1.72225 WP_003689664.1.72384 WP_003689664.1.72495 WP_003689664.1.72699 WP_003689664.1.72726 WP_003689664.1.72840 WP_003689664.1.73313 WP_003689664.1.73620 WP_003689664.1.73930 WP_003689664.1.74343 WP_003689664.1.74542 WP_003689664.1.74619 WP_003689664.1.74643 WP_003689664.1.74664 WP_003689664.1.75113 WP_003689664.1.7522 WP_003689664.1.75279 WP_003689664.1.756 WP_003689664.1.75674 WP_003689664.1.7615 WP_003689664.1.76478 WP_003689664.1.77089 WP_003689664.1.77580 WP_003689664.1.77864 WP_003689664.1.7798 WP_003689664.1.78114 WP_003689664.1.78239 WP_003689664.1.78247 WP_003689664.1.78732 WP_003689664.1.78753 WP_003689664.1.7897 WP_003689664.1.78972 WP_003689664.1.79000 WP_003689664.1.79980 WP_003689664.1.80173 WP_003689664.1.80312 WP_003689664.1.80423 WP_003689664.1.81926 WP_003689664.1.82336 WP_003689664.1.82560 WP_003689664.1.827 WP_003689664.1.83048 WP_003689664.1.83346 WP_003689664.1.83631 WP_003689664.1.84030 WP_003689664.1.84035 WP_003689664.1.8435 WP_003689664.1.84421 WP_003689664.1.84853 WP_003689664.1.84886 WP_003689664.1.84927 WP_003689664.1.85137 WP_003689664.1.85285 WP_003689664.1.85288 WP_003689664.1.85439 WP_003689664.1.85530 WP_003689664.1.85632 WP_003689664.1.85925 WP_003689664.1.85988 WP_003689664.1.86819 WP_003689664.1.86978 WP_003689664.1.87176 WP_003689664.1.87542 WP_003689664.1.87729 WP_003689664.1.88158 WP_003689664.1.88213 WP_003689664.1.8824 WP_003689664.1.89770 WP_003689664.1.90025 WP_003689664.1.90351 WP_003689664.1.9054 WP_003689664.1.90659 WP_003689664.1.91401 WP_003689664.1.91463 WP_003689664.1.91535 WP_003689664.1.91671 WP_003689664.1.91698 WP_003689664.1.91889 WP_003689664.1.92250 WP_003689664.1.92483 WP_003689664.1.92635 WP_003689664.1.92766 WP_003689664.1.93389 WP_003689664.1.93791 WP_003689664.1.93847 WP_003689664.1.94006 WP_003689664.1.94038 WP_003689664.1.94083 WP_003689664.1.94131 WP_003689664.1.94164 WP_003689664.1.94609 WP_003689664.1.9501 WP_003689664.1.95164 WP_003689664.1.95636 WP_003689664.1.95791 WP_003689664.1.95891 WP_003689664.1.9598 WP_003689664.1.96806 WP_003689664.1.96988 WP_003689664.1.97104 WP_003689664.1.97177 WP_003689664.1.97332 WP_003689664.1.97455 WP_003689664.1.97492 WP_003689664.1.9754 WP_003689664.1.98029 WP_003689664.1.98365 WP_003689664.1.98671 WP_003689664.1.98909 WP_003689664.1.99118 WP_003689664.1.99147 WP_003689664.1.99189 WP_003689664.1.99247 WP_003689664.1.99374 WP_003689664.1.99376 WP_003689664.1.99719 WP_003689664.1.99822 WP_003689664.1.99840 YP_208292.1.29278 gi|59801580|ref|YP_208292.1| 242231.NGO1221 521006.NGK_0289 gi|385335096|ref|YP_005889043.1| gi|194097869|ref|YP_002000914.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]