SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|194099133|ref|YP_002002218.1| from Neisseria gonorrhoeae NCCP11945

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|194099133|ref|YP_002002218.1|
Domain Number 1 Region: 127-262
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.96e-24
Family GntR ligand-binding domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 32-107
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.17e-19
Family GntR-like transcriptional regulators 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|194099133|ref|YP_002002218.1|
Sequence length 290
Comment GntR family transcriptional regulator [Neisseria gonorrhoeae NCCP11945]
Sequence
MSLESALIGQSNLMFDVFRKGSAGNLYKGGVMKLVRSQKISDQVLSVLEGRIVEGVYAEG
GKIPPERVLAEEFGVSRPSVRSALNILVARQILEARQGDGYYVSVKPQQDFLQSWQELLG
KHSNWEQDVFDFSCHIEGCMAALAAERRTDADLKRIRFWLEKFEEACGSGNLEHQGEADV
SFHQTIADAAHNLLFSHLSGGLLKMLYRQTRSSLIYLNQEEDPRPKLMAQHRVLYEAISN
RRPGEASEAAKAHLNYVASSILKDREYQSRNRHADTLAQNDLKRVQDWEV
Download sequence
Identical sequences B4RN83
gi|194099133|ref|YP_002002218.1| 521006.NGK_1593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]