SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|400406114|ref|YP_006588862.1| from secondary endosymbiont of Heteropsylla cubana Thao2000

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|400406114|ref|YP_006588862.1|
Domain Number 1 Region: 1-249
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.08e-47
Family Protein serine/threonine phosphatase 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|400406114|ref|YP_006588862.1|
Sequence length 274
Comment symmetrical bis(5'-nucleosyl)-tetraphosphatase [secondary endosymbiont of Heteropsylla cubana]
Sequence
MSTYLIGDIHGCYNEFNMILDQVSFNPEIDTLWVTGDLISRKINSIKVIRLLYSIRKSVR
LVLGNHDLHFLSLYYCANQNHETTLINPNILVSTDIDKLIHWLRNQPMLQIDEEKYIIMT
HAGITPQWDISIARRCAHELETMLKSDDYHLFLQAMYGDTPNQWSEKLSGLERLRFIANA
FTRIRYCFLDGQLEMSYKGIPREAPSNLFPWFKLIRPEILGNYNIIFGHWASLMGRGTPT
NIYGLDTGCCWGKKMTLLRWEDKMFTYVPALLNT
Download sequence
Identical sequences J3Z554
gi|400406114|ref|YP_006588862.1| WP_014888731.1.66110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]