SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186893729|ref|YP_001870841.1| from Yersinia pseudotuberculosis PB1/+

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186893729|ref|YP_001870841.1|
Domain Number 1 Region: 21-333
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 9.77e-72
Family FMN-linked oxidoreductases 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186893729|ref|YP_001870841.1|
Sequence length 345
Comment tRNA-dihydrouridine synthase A [Yersinia pseudotuberculosis PB1/+]
Sequence
MHEAQTFSSTPATKPQYPLQRFSVAPMLDWTDRHCRYFHRLLTKQALLYTEMVTTGAIIH
GKADYLAYSEQDHPVALQLGGSDPQALAHCAKLAEQRGYNEINLNVGCPSDRVQNGRFGA
CLMGEADLVADCIKAMRDAVAIPVTVKTRIGIDQLDSYEFLCEFVQTVAERGECEIFTIH
ARKAWLSGLSPKENREVPPLDYERVYQLKRDFPALTIAINGGVKTLAEAKEHLKHLDGVM
MGREAYQNPGILTQVDRELFDPHAPVVDSVKAIEALYPYIEQELSQGAYLGHITRHILGI
FQGIPGARQWRRHLSENAHKPGAGVSVVEEALALVSPSYYESVGG
Download sequence
Identical sequences A0A0U1EWX3 A0A2A7VKQ2 Q66FG5
gi|51594726|ref|YP_068917.1| WP_011191594.1.20547 WP_011191594.1.20932 WP_011191594.1.26383 WP_011191594.1.32736 WP_011191594.1.33324 WP_011191594.1.46697 WP_011191594.1.49315 WP_011191594.1.50185 WP_011191594.1.53883 WP_011191594.1.63641 WP_011191594.1.6791 WP_011191594.1.75208 273123.YPTB0372 502801.YPTS_0395 gi|186893729|ref|YP_001870841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]