SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186894623|ref|YP_001871735.1| from Yersinia pseudotuberculosis PB1/+

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186894623|ref|YP_001871735.1|
Domain Number 1 Region: 3-304
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.97e-71
Family FMN-linked oxidoreductases 0.0000767
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186894623|ref|YP_001871735.1|
Sequence length 314
Comment tRNA-dihydrouridine synthase C [Yersinia pseudotuberculosis PB1/+]
Sequence
MSMRVILAPMEGVLDSLVRELLSEVNDYDLCITEFLRVVDQLLPAKSFYRLCPELHNQSR
TQSGTLVRIQLLGQYPEWLAENAARAVALGSYGVDLNCGCPSKLVNGSGGGATLLKDPEL
IYQGAKAMRAAVPAHLPVTVKIRLGWDSGDRQFEIADAVQQAGATELAVHGRTKEDGYQA
ERINWQAIGEIRQRLTIPVIANGEIWDYQSAQECMKVTGCDAVMLGRGALNVPNLSRVVK
YNEPRMPWLEVVKLLQKYVQLEKQGDTGLYHVARIKQWLGYLRKEYTEATDLFGEIRALK
NSKDIALAIQRINR
Download sequence
Identical sequences A0A0H2Y4A8 A0A0H2YLA5 A0A0H3B614 A0A0M1V6R3 A0A0U1EQF5 A0A208S651 A0A2A7VDR7 Q66D33
gi|22126892|ref|NP_670315.1| gi|51595560|ref|YP_069751.1| 187410.y3015 214092.YPO1175 229193.YP_0963 273123.YPTB1216 349746.YpAngola_A1355 360102.YPA_0885 377628.YPN_2803 386656.YPDSF_2522 502800.YPK_2887 502801.YPTS_1303 gi|294503193|ref|YP_003567255.1| gi|384125567|ref|YP_005508181.1| gi|45440801|ref|NP_992340.1| gi|162420578|ref|YP_001605884.1| gi|108812963|ref|YP_648730.1| gi|145599791|ref|YP_001163867.1| gi|186894623|ref|YP_001871735.1| gi|218928338|ref|YP_002346213.1| gi|384121636|ref|YP_005504256.1| gi|108806882|ref|YP_650798.1| gi|170025109|ref|YP_001721614.1| WP_002210777.1.100246 WP_002210777.1.10066 WP_002210777.1.100921 WP_002210777.1.100931 WP_002210777.1.10105 WP_002210777.1.101305 WP_002210777.1.101382 WP_002210777.1.101928 WP_002210777.1.102012 WP_002210777.1.102067 WP_002210777.1.10736 WP_002210777.1.10935 WP_002210777.1.11693 WP_002210777.1.12167 WP_002210777.1.12463 WP_002210777.1.12736 WP_002210777.1.12857 WP_002210777.1.1388 WP_002210777.1.14063 WP_002210777.1.14169 WP_002210777.1.15321 WP_002210777.1.15555 WP_002210777.1.15605 WP_002210777.1.15689 WP_002210777.1.16243 WP_002210777.1.16333 WP_002210777.1.17135 WP_002210777.1.17141 WP_002210777.1.17608 WP_002210777.1.17873 WP_002210777.1.17983 WP_002210777.1.18208 WP_002210777.1.18640 WP_002210777.1.18826 WP_002210777.1.19329 WP_002210777.1.19425 WP_002210777.1.19739 WP_002210777.1.19763 WP_002210777.1.20380 WP_002210777.1.20547 WP_002210777.1.2064 WP_002210777.1.20932 WP_002210777.1.21486 WP_002210777.1.21784 WP_002210777.1.21879 WP_002210777.1.21934 WP_002210777.1.22542 WP_002210777.1.22708 WP_002210777.1.23157 WP_002210777.1.23271 WP_002210777.1.23687 WP_002210777.1.23811 WP_002210777.1.24002 WP_002210777.1.2451 WP_002210777.1.24517 WP_002210777.1.25181 WP_002210777.1.25394 WP_002210777.1.26383 WP_002210777.1.2640 WP_002210777.1.26776 WP_002210777.1.26960 WP_002210777.1.27124 WP_002210777.1.27251 WP_002210777.1.2726 WP_002210777.1.28647 WP_002210777.1.28922 WP_002210777.1.29157 WP_002210777.1.29186 WP_002210777.1.29355 WP_002210777.1.2947 WP_002210777.1.29622 WP_002210777.1.2964 WP_002210777.1.29685 WP_002210777.1.29814 WP_002210777.1.3092 WP_002210777.1.30931 WP_002210777.1.311 WP_002210777.1.31336 WP_002210777.1.31496 WP_002210777.1.31721 WP_002210777.1.31739 WP_002210777.1.31805 WP_002210777.1.32343 WP_002210777.1.32388 WP_002210777.1.32446 WP_002210777.1.32736 WP_002210777.1.33203 WP_002210777.1.33324 WP_002210777.1.33661 WP_002210777.1.33937 WP_002210777.1.34031 WP_002210777.1.34138 WP_002210777.1.35389 WP_002210777.1.35538 WP_002210777.1.36088 WP_002210777.1.37174 WP_002210777.1.37494 WP_002210777.1.37863 WP_002210777.1.38235 WP_002210777.1.38743 WP_002210777.1.38824 WP_002210777.1.38993 WP_002210777.1.39066 WP_002210777.1.39346 WP_002210777.1.3976 WP_002210777.1.39858 WP_002210777.1.40071 WP_002210777.1.40134 WP_002210777.1.40534 WP_002210777.1.40853 WP_002210777.1.41196 WP_002210777.1.4210 WP_002210777.1.42361 WP_002210777.1.42490 WP_002210777.1.42976 WP_002210777.1.44408 WP_002210777.1.44598 WP_002210777.1.44603 WP_002210777.1.44832 WP_002210777.1.45198 WP_002210777.1.45214 WP_002210777.1.46262 WP_002210777.1.46545 WP_002210777.1.46686 WP_002210777.1.46697 WP_002210777.1.46731 WP_002210777.1.4678 WP_002210777.1.46891 WP_002210777.1.47387 WP_002210777.1.47440 WP_002210777.1.47769 WP_002210777.1.47881 WP_002210777.1.48166 WP_002210777.1.48722 WP_002210777.1.4889 WP_002210777.1.49315 WP_002210777.1.49906 WP_002210777.1.4997 WP_002210777.1.50010 WP_002210777.1.50093 WP_002210777.1.50106 WP_002210777.1.50185 WP_002210777.1.50984 WP_002210777.1.51284 WP_002210777.1.51293 WP_002210777.1.51588 WP_002210777.1.51772 WP_002210777.1.51934 WP_002210777.1.52158 WP_002210777.1.52247 WP_002210777.1.52473 WP_002210777.1.52734 WP_002210777.1.52792 WP_002210777.1.52819 WP_002210777.1.52969 WP_002210777.1.53147 WP_002210777.1.53300 WP_002210777.1.53838 WP_002210777.1.53848 WP_002210777.1.53883 WP_002210777.1.53953 WP_002210777.1.54568 WP_002210777.1.54951 WP_002210777.1.55194 WP_002210777.1.55695 WP_002210777.1.5592 WP_002210777.1.56031 WP_002210777.1.56912 WP_002210777.1.56953 WP_002210777.1.57585 WP_002210777.1.57657 WP_002210777.1.58067 WP_002210777.1.58543 WP_002210777.1.58794 WP_002210777.1.59102 WP_002210777.1.59431 WP_002210777.1.5957 WP_002210777.1.59635 WP_002210777.1.5968 WP_002210777.1.59687 WP_002210777.1.59789 WP_002210777.1.59885 WP_002210777.1.60437 WP_002210777.1.60707 WP_002210777.1.60896 WP_002210777.1.61689 WP_002210777.1.62232 WP_002210777.1.62342 WP_002210777.1.6270 WP_002210777.1.63387 WP_002210777.1.63641 WP_002210777.1.64142 WP_002210777.1.64780 WP_002210777.1.64786 WP_002210777.1.64910 WP_002210777.1.653 WP_002210777.1.65400 WP_002210777.1.65554 WP_002210777.1.6570 WP_002210777.1.65706 WP_002210777.1.65718 WP_002210777.1.6581 WP_002210777.1.66546 WP_002210777.1.66616 WP_002210777.1.67404 WP_002210777.1.67850 WP_002210777.1.6791 WP_002210777.1.68361 WP_002210777.1.68753 WP_002210777.1.68855 WP_002210777.1.69018 WP_002210777.1.69316 WP_002210777.1.69951 WP_002210777.1.70117 WP_002210777.1.70171 WP_002210777.1.70319 WP_002210777.1.70377 WP_002210777.1.70417 WP_002210777.1.70726 WP_002210777.1.7083 WP_002210777.1.7169 WP_002210777.1.71744 WP_002210777.1.72280 WP_002210777.1.72440 WP_002210777.1.72486 WP_002210777.1.7402 WP_002210777.1.74131 WP_002210777.1.74310 WP_002210777.1.74577 WP_002210777.1.74738 WP_002210777.1.75169 WP_002210777.1.7518 WP_002210777.1.75208 WP_002210777.1.75337 WP_002210777.1.75636 WP_002210777.1.75689 WP_002210777.1.75821 WP_002210777.1.76555 WP_002210777.1.76670 WP_002210777.1.77295 WP_002210777.1.77387 WP_002210777.1.77429 WP_002210777.1.77569 WP_002210777.1.78004 WP_002210777.1.7841 WP_002210777.1.78556 WP_002210777.1.79515 WP_002210777.1.79550 WP_002210777.1.79609 WP_002210777.1.79825 WP_002210777.1.79981 WP_002210777.1.8009 WP_002210777.1.80331 WP_002210777.1.81848 WP_002210777.1.81877 WP_002210777.1.8210 WP_002210777.1.82133 WP_002210777.1.82151 WP_002210777.1.82270 WP_002210777.1.82436 WP_002210777.1.82619 WP_002210777.1.8303 WP_002210777.1.83039 WP_002210777.1.83265 WP_002210777.1.8420 WP_002210777.1.84703 WP_002210777.1.84720 WP_002210777.1.85269 WP_002210777.1.85270 WP_002210777.1.8559 WP_002210777.1.85802 WP_002210777.1.86034 WP_002210777.1.86059 WP_002210777.1.86413 WP_002210777.1.87107 WP_002210777.1.8728 WP_002210777.1.87418 WP_002210777.1.8762 WP_002210777.1.87853 WP_002210777.1.87988 WP_002210777.1.88362 WP_002210777.1.88472 WP_002210777.1.89359 WP_002210777.1.8964 WP_002210777.1.90176 WP_002210777.1.9051 WP_002210777.1.90624 WP_002210777.1.91263 WP_002210777.1.91373 WP_002210777.1.91844 WP_002210777.1.92030 WP_002210777.1.92331 WP_002210777.1.92604 WP_002210777.1.927 WP_002210777.1.9311 WP_002210777.1.9320 WP_002210777.1.93623 WP_002210777.1.93928 WP_002210777.1.93933 WP_002210777.1.94052 WP_002210777.1.94201 WP_002210777.1.94545 WP_002210777.1.94683 WP_002210777.1.95746 WP_002210777.1.95981 WP_002210777.1.97245 WP_002210777.1.97375 WP_002210777.1.97448 WP_002210777.1.97791 WP_002210777.1.97864 WP_002210777.1.97894 WP_002210777.1.99109 WP_002210777.1.99383 WP_002210777.1.9941 WP_002210777.1.99416 WP_002210777.1.99788 WP_002210777.1.99882 WP_002210777.1.99972 WP_002210777.1.99990 YP_002346213.1.25044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]