SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186894860|ref|YP_001871972.1| from Yersinia pseudotuberculosis PB1/+

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186894860|ref|YP_001871972.1|
Domain Number 1 Region: 1-334
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.19e-106
Family FMN-linked oxidoreductases 0.0000000000489
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186894860|ref|YP_001871972.1|
Sequence length 336
Comment dihydroorotate dehydrogenase 2 [Yersinia pseudotuberculosis PB1/+]
Sequence
MYYPLVRKALFQLDPERAHELTFRQLKRVSGTPLEFLVRQSVPTKPVSCMGLSFKNPVGL
AAGLDKDGECIDALGAMGFGFIEVGTVTPRPQVGNDKPRLFRIVEAEGLINRMGFNNHGV
DNLIENVKKSHFGGILGINIGKNKDTPVEQGKEDYLICMDKIYPYAGYIAINISSPNTPG
LRSLQYGEALDDLLAAIKDKQTELHQRHHKYVPVAVKIAPDLTEEELIQIADSLVRHNID
GVIATNTTLDRSLIQGLNYCEQAGGLSGRPLQLRSTEVIHRLSQELKGRLPIIGVGGIDS
VTAAREKMAAGASLIQIYSGFIFRGPGLIKNIVTHI
Download sequence
Identical sequences A0A0E1NYU1 A0A0M1V4Y6 A0A0U1EX74 A0A154SMQ9 A0A208RUT0 A0A2A7VEG7 A4TMZ3 A7FJU2 A9R7L2 B1JQS0 B2JYR8 Q1CA44 Q1CGJ0 Q66CG4 Q8ZG91
gi|22126632|ref|NP_670055.1| gi|153948054|ref|YP_001401520.1| gi|384140777|ref|YP_005523479.1| gi|145599552|ref|YP_001163628.1| gi|108806707|ref|YP_650623.1| gi|162421364|ref|YP_001606457.1| WP_002211296.1.100083 WP_002211296.1.100246 WP_002211296.1.100593 WP_002211296.1.10066 WP_002211296.1.100921 WP_002211296.1.10105 WP_002211296.1.101305 WP_002211296.1.101382 WP_002211296.1.101928 WP_002211296.1.102012 WP_002211296.1.102067 WP_002211296.1.10736 WP_002211296.1.10935 WP_002211296.1.10955 WP_002211296.1.11693 WP_002211296.1.12167 WP_002211296.1.12463 WP_002211296.1.12736 WP_002211296.1.12857 WP_002211296.1.1388 WP_002211296.1.14063 WP_002211296.1.14169 WP_002211296.1.14804 WP_002211296.1.15321 WP_002211296.1.15555 WP_002211296.1.15605 WP_002211296.1.15689 WP_002211296.1.16243 WP_002211296.1.16333 WP_002211296.1.17141 WP_002211296.1.17608 WP_002211296.1.17873 WP_002211296.1.17983 WP_002211296.1.18208 WP_002211296.1.18640 WP_002211296.1.18826 WP_002211296.1.19329 WP_002211296.1.19425 WP_002211296.1.19739 WP_002211296.1.19763 WP_002211296.1.20380 WP_002211296.1.20547 WP_002211296.1.2064 WP_002211296.1.20932 WP_002211296.1.21486 WP_002211296.1.21784 WP_002211296.1.21879 WP_002211296.1.21934 WP_002211296.1.22530 WP_002211296.1.23157 WP_002211296.1.23271 WP_002211296.1.23687 WP_002211296.1.23811 WP_002211296.1.24002 WP_002211296.1.2451 WP_002211296.1.24517 WP_002211296.1.25181 WP_002211296.1.25394 WP_002211296.1.26383 WP_002211296.1.2640 WP_002211296.1.26776 WP_002211296.1.26960 WP_002211296.1.27124 WP_002211296.1.27251 WP_002211296.1.2726 WP_002211296.1.28647 WP_002211296.1.28922 WP_002211296.1.29157 WP_002211296.1.29355 WP_002211296.1.2947 WP_002211296.1.29622 WP_002211296.1.2964 WP_002211296.1.29685 WP_002211296.1.29814 WP_002211296.1.3092 WP_002211296.1.30931 WP_002211296.1.311 WP_002211296.1.31336 WP_002211296.1.31496 WP_002211296.1.31739 WP_002211296.1.31805 WP_002211296.1.32343 WP_002211296.1.32388 WP_002211296.1.32446 WP_002211296.1.32736 WP_002211296.1.33203 WP_002211296.1.33324 WP_002211296.1.33661 WP_002211296.1.33937 WP_002211296.1.34031 WP_002211296.1.34138 WP_002211296.1.35389 WP_002211296.1.35538 WP_002211296.1.36088 WP_002211296.1.37174 WP_002211296.1.37494 WP_002211296.1.37863 WP_002211296.1.38235 WP_002211296.1.38532 WP_002211296.1.38743 WP_002211296.1.38824 WP_002211296.1.38993 WP_002211296.1.39066 WP_002211296.1.3976 WP_002211296.1.39858 WP_002211296.1.40071 WP_002211296.1.40134 WP_002211296.1.40534 WP_002211296.1.40853 WP_002211296.1.41196 WP_002211296.1.4210 WP_002211296.1.42361 WP_002211296.1.42490 WP_002211296.1.42976 WP_002211296.1.44408 WP_002211296.1.44598 WP_002211296.1.44832 WP_002211296.1.45198 WP_002211296.1.45214 WP_002211296.1.46262 WP_002211296.1.46545 WP_002211296.1.46686 WP_002211296.1.46697 WP_002211296.1.46731 WP_002211296.1.4678 WP_002211296.1.46891 WP_002211296.1.47387 WP_002211296.1.47440 WP_002211296.1.47769 WP_002211296.1.47881 WP_002211296.1.48722 WP_002211296.1.4889 WP_002211296.1.49315 WP_002211296.1.49906 WP_002211296.1.4997 WP_002211296.1.50010 WP_002211296.1.50093 WP_002211296.1.50185 WP_002211296.1.50984 WP_002211296.1.51284 WP_002211296.1.51293 WP_002211296.1.51588 WP_002211296.1.51772 WP_002211296.1.51934 WP_002211296.1.52158 WP_002211296.1.52247 WP_002211296.1.52734 WP_002211296.1.52792 WP_002211296.1.52819 WP_002211296.1.53147 WP_002211296.1.53300 WP_002211296.1.53838 WP_002211296.1.53848 WP_002211296.1.53883 WP_002211296.1.53953 WP_002211296.1.54568 WP_002211296.1.54951 WP_002211296.1.55194 WP_002211296.1.5592 WP_002211296.1.56031 WP_002211296.1.56912 WP_002211296.1.57585 WP_002211296.1.57657 WP_002211296.1.58067 WP_002211296.1.58543 WP_002211296.1.58794 WP_002211296.1.59102 WP_002211296.1.59431 WP_002211296.1.5957 WP_002211296.1.59635 WP_002211296.1.59789 WP_002211296.1.59885 WP_002211296.1.60437 WP_002211296.1.60707 WP_002211296.1.60896 WP_002211296.1.62232 WP_002211296.1.62342 WP_002211296.1.6270 WP_002211296.1.63387 WP_002211296.1.63641 WP_002211296.1.64142 WP_002211296.1.64474 WP_002211296.1.64780 WP_002211296.1.64786 WP_002211296.1.64910 WP_002211296.1.653 WP_002211296.1.65400 WP_002211296.1.65554 WP_002211296.1.6570 WP_002211296.1.65706 WP_002211296.1.65718 WP_002211296.1.6581 WP_002211296.1.66118 WP_002211296.1.66546 WP_002211296.1.66616 WP_002211296.1.67404 WP_002211296.1.67850 WP_002211296.1.6791 WP_002211296.1.68361 WP_002211296.1.68371 WP_002211296.1.68753 WP_002211296.1.68855 WP_002211296.1.69018 WP_002211296.1.69316 WP_002211296.1.69951 WP_002211296.1.70117 WP_002211296.1.70171 WP_002211296.1.70319 WP_002211296.1.70377 WP_002211296.1.70417 WP_002211296.1.70726 WP_002211296.1.7083 WP_002211296.1.7169 WP_002211296.1.71744 WP_002211296.1.72280 WP_002211296.1.72440 WP_002211296.1.72486 WP_002211296.1.7402 WP_002211296.1.74131 WP_002211296.1.74310 WP_002211296.1.74577 WP_002211296.1.74738 WP_002211296.1.7518 WP_002211296.1.75208 WP_002211296.1.75337 WP_002211296.1.75636 WP_002211296.1.75689 WP_002211296.1.76670 WP_002211296.1.77387 WP_002211296.1.77429 WP_002211296.1.77691 WP_002211296.1.78004 WP_002211296.1.7841 WP_002211296.1.78556 WP_002211296.1.79550 WP_002211296.1.79981 WP_002211296.1.8009 WP_002211296.1.80331 WP_002211296.1.81848 WP_002211296.1.81877 WP_002211296.1.8210 WP_002211296.1.82133 WP_002211296.1.82151 WP_002211296.1.82270 WP_002211296.1.82436 WP_002211296.1.82619 WP_002211296.1.8303 WP_002211296.1.83039 WP_002211296.1.83265 WP_002211296.1.8420 WP_002211296.1.84703 WP_002211296.1.84720 WP_002211296.1.85269 WP_002211296.1.85270 WP_002211296.1.8559 WP_002211296.1.85802 WP_002211296.1.86034 WP_002211296.1.86059 WP_002211296.1.86413 WP_002211296.1.87107 WP_002211296.1.8728 WP_002211296.1.87418 WP_002211296.1.8762 WP_002211296.1.87853 WP_002211296.1.87988 WP_002211296.1.88362 WP_002211296.1.88472 WP_002211296.1.89359 WP_002211296.1.89542 WP_002211296.1.8964 WP_002211296.1.90176 WP_002211296.1.9051 WP_002211296.1.90624 WP_002211296.1.91373 WP_002211296.1.91844 WP_002211296.1.92030 WP_002211296.1.92331 WP_002211296.1.92604 WP_002211296.1.927 WP_002211296.1.9311 WP_002211296.1.9320 WP_002211296.1.93623 WP_002211296.1.93928 WP_002211296.1.94052 WP_002211296.1.94201 WP_002211296.1.94545 WP_002211296.1.94683 WP_002211296.1.95746 WP_002211296.1.95981 WP_002211296.1.97245 WP_002211296.1.97375 WP_002211296.1.97448 WP_002211296.1.97791 WP_002211296.1.97864 WP_002211296.1.97894 WP_002211296.1.99109 WP_002211296.1.99383 WP_002211296.1.9941 WP_002211296.1.99416 WP_002211296.1.99788 WP_002211296.1.99882 WP_002211296.1.99990 YP_002346438.1.25044 gi|384415214|ref|YP_005624576.1| IDP04724 gi|384121849|ref|YP_005504469.1| gi|186894860|ref|YP_001871972.1| gi|218928563|ref|YP_002346438.1| gi|294503402|ref|YP_003567464.1| gi|170024869|ref|YP_001721374.1| 187410.y2755 214092.YPO1415 273123.YPTB1439 349746.YpAngola_A1984 349747.YpsIP31758_2555 360102.YPA_0710 377628.YPN_2562 386656.YPDSF_2280 502800.YPK_2644 502801.YPTS_1543 gi|108812723|ref|YP_648490.1| gi|51595779|ref|YP_069970.1| gi|384125357|ref|YP_005507971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]