SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186894885|ref|YP_001871997.1| from Yersinia pseudotuberculosis PB1/+

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186894885|ref|YP_001871997.1|
Domain Number 1 Region: 4-96
Classification Level Classification E-value
Superfamily YccV-like 6.02e-30
Family YccV-like 0.0000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186894885|ref|YP_001871997.1|
Sequence length 105
Comment heat shock protein HspQ [Yersinia pseudotuberculosis PB1/+]
Sequence
MIASKFGIGQQVRHSLHGYLGVVIDIDPEYSLAPPEPDEVANNKTLRSSPWYHVVIEDDD
GQPVHTYLAEAQLTYEDVDAHPEQPSLDELAASIRHQLQAPHLRN
Download sequence
Identical sequences A0A0E1NVE7 A0A0E8XHV9 A0A0M1V1L5 A0A0U1EVQ1 A0A154MN38 A0A208RXQ0 A0A2A7VE96 A4TKV5 A7FJR9 A9R2N8 B1JQP7 B2JYU3 Q1CA18 Q1CGL7 Q66CE1 Q7CHM0
gi|384140676|ref|YP_005523378.1| gi|384415184|ref|YP_005624546.1| gi|294503428|ref|YP_003567490.1| gi|384125734|ref|YP_005508348.1| gi|384121875|ref|YP_005504495.1| gi|145598814|ref|YP_001162890.1| gi|153947166|ref|YP_001401497.1| gi|186894885|ref|YP_001871997.1| WP_002213054.1.100083 WP_002213054.1.100246 WP_002213054.1.100593 WP_002213054.1.10066 WP_002213054.1.100921 WP_002213054.1.100931 WP_002213054.1.10105 WP_002213054.1.101305 WP_002213054.1.101382 WP_002213054.1.101928 WP_002213054.1.102012 WP_002213054.1.102067 WP_002213054.1.10736 WP_002213054.1.10935 WP_002213054.1.10955 WP_002213054.1.11693 WP_002213054.1.12167 WP_002213054.1.12463 WP_002213054.1.12736 WP_002213054.1.12857 WP_002213054.1.1388 WP_002213054.1.14063 WP_002213054.1.14169 WP_002213054.1.14804 WP_002213054.1.15321 WP_002213054.1.15555 WP_002213054.1.15605 WP_002213054.1.15689 WP_002213054.1.16243 WP_002213054.1.16333 WP_002213054.1.17135 WP_002213054.1.17141 WP_002213054.1.17608 WP_002213054.1.17873 WP_002213054.1.17983 WP_002213054.1.18208 WP_002213054.1.18640 WP_002213054.1.18826 WP_002213054.1.19329 WP_002213054.1.19425 WP_002213054.1.19739 WP_002213054.1.19763 WP_002213054.1.20035 WP_002213054.1.20380 WP_002213054.1.20547 WP_002213054.1.2064 WP_002213054.1.20932 WP_002213054.1.21486 WP_002213054.1.21784 WP_002213054.1.21879 WP_002213054.1.21934 WP_002213054.1.22530 WP_002213054.1.22542 WP_002213054.1.22708 WP_002213054.1.23157 WP_002213054.1.23271 WP_002213054.1.23687 WP_002213054.1.23811 WP_002213054.1.24002 WP_002213054.1.2451 WP_002213054.1.24517 WP_002213054.1.25181 WP_002213054.1.25394 WP_002213054.1.26383 WP_002213054.1.2640 WP_002213054.1.26509 WP_002213054.1.26776 WP_002213054.1.26960 WP_002213054.1.27124 WP_002213054.1.27251 WP_002213054.1.2726 WP_002213054.1.28922 WP_002213054.1.29157 WP_002213054.1.29186 WP_002213054.1.29355 WP_002213054.1.2947 WP_002213054.1.29622 WP_002213054.1.2964 WP_002213054.1.29685 WP_002213054.1.29814 WP_002213054.1.3092 WP_002213054.1.30931 WP_002213054.1.311 WP_002213054.1.31336 WP_002213054.1.31496 WP_002213054.1.31721 WP_002213054.1.31739 WP_002213054.1.31805 WP_002213054.1.32343 WP_002213054.1.32388 WP_002213054.1.32446 WP_002213054.1.32736 WP_002213054.1.33203 WP_002213054.1.33324 WP_002213054.1.33661 WP_002213054.1.33775 WP_002213054.1.33937 WP_002213054.1.34031 WP_002213054.1.34138 WP_002213054.1.35389 WP_002213054.1.35538 WP_002213054.1.36088 WP_002213054.1.37174 WP_002213054.1.37494 WP_002213054.1.37863 WP_002213054.1.38147 WP_002213054.1.38235 WP_002213054.1.38532 WP_002213054.1.38743 WP_002213054.1.38824 WP_002213054.1.38993 WP_002213054.1.39066 WP_002213054.1.39346 WP_002213054.1.3976 WP_002213054.1.39858 WP_002213054.1.40071 WP_002213054.1.40134 WP_002213054.1.40534 WP_002213054.1.40853 WP_002213054.1.41196 WP_002213054.1.41984 WP_002213054.1.4210 WP_002213054.1.42361 WP_002213054.1.42490 WP_002213054.1.42976 WP_002213054.1.44408 WP_002213054.1.44598 WP_002213054.1.44603 WP_002213054.1.44832 WP_002213054.1.45198 WP_002213054.1.45214 WP_002213054.1.46262 WP_002213054.1.46545 WP_002213054.1.46686 WP_002213054.1.46697 WP_002213054.1.46731 WP_002213054.1.4678 WP_002213054.1.46891 WP_002213054.1.47387 WP_002213054.1.47440 WP_002213054.1.47769 WP_002213054.1.47881 WP_002213054.1.48166 WP_002213054.1.48722 WP_002213054.1.4889 WP_002213054.1.49315 WP_002213054.1.49906 WP_002213054.1.4997 WP_002213054.1.50010 WP_002213054.1.50093 WP_002213054.1.50106 WP_002213054.1.50185 WP_002213054.1.50984 WP_002213054.1.51284 WP_002213054.1.51293 WP_002213054.1.51588 WP_002213054.1.51772 WP_002213054.1.51934 WP_002213054.1.52158 WP_002213054.1.52247 WP_002213054.1.52473 WP_002213054.1.52569 WP_002213054.1.52734 WP_002213054.1.52792 WP_002213054.1.52819 WP_002213054.1.52969 WP_002213054.1.53147 WP_002213054.1.53300 WP_002213054.1.53838 WP_002213054.1.53848 WP_002213054.1.53883 WP_002213054.1.53953 WP_002213054.1.54568 WP_002213054.1.54951 WP_002213054.1.55194 WP_002213054.1.55695 WP_002213054.1.5592 WP_002213054.1.56031 WP_002213054.1.56912 WP_002213054.1.56953 WP_002213054.1.57585 WP_002213054.1.57657 WP_002213054.1.58067 WP_002213054.1.58543 WP_002213054.1.58794 WP_002213054.1.59102 WP_002213054.1.59431 WP_002213054.1.5957 WP_002213054.1.59635 WP_002213054.1.5968 WP_002213054.1.59687 WP_002213054.1.59789 WP_002213054.1.59885 WP_002213054.1.60437 WP_002213054.1.60707 WP_002213054.1.60896 WP_002213054.1.61689 WP_002213054.1.62232 WP_002213054.1.62342 WP_002213054.1.6270 WP_002213054.1.6333 WP_002213054.1.63387 WP_002213054.1.63517 WP_002213054.1.63641 WP_002213054.1.64142 WP_002213054.1.64474 WP_002213054.1.64780 WP_002213054.1.64786 WP_002213054.1.64910 WP_002213054.1.653 WP_002213054.1.65400 WP_002213054.1.65554 WP_002213054.1.6570 WP_002213054.1.65706 WP_002213054.1.65718 WP_002213054.1.6581 WP_002213054.1.66118 WP_002213054.1.66546 WP_002213054.1.66616 WP_002213054.1.67404 WP_002213054.1.67850 WP_002213054.1.6791 WP_002213054.1.68361 WP_002213054.1.68371 WP_002213054.1.68753 WP_002213054.1.68855 WP_002213054.1.69018 WP_002213054.1.69316 WP_002213054.1.69951 WP_002213054.1.70117 WP_002213054.1.70171 WP_002213054.1.70319 WP_002213054.1.70377 WP_002213054.1.70417 WP_002213054.1.70726 WP_002213054.1.7083 WP_002213054.1.7169 WP_002213054.1.71744 WP_002213054.1.72280 WP_002213054.1.72440 WP_002213054.1.72486 WP_002213054.1.7402 WP_002213054.1.74131 WP_002213054.1.74310 WP_002213054.1.74577 WP_002213054.1.74738 WP_002213054.1.75169 WP_002213054.1.75173 WP_002213054.1.7518 WP_002213054.1.75208 WP_002213054.1.75337 WP_002213054.1.75407 WP_002213054.1.75636 WP_002213054.1.75689 WP_002213054.1.75821 WP_002213054.1.76555 WP_002213054.1.76670 WP_002213054.1.77295 WP_002213054.1.77387 WP_002213054.1.77429 WP_002213054.1.77569 WP_002213054.1.78004 WP_002213054.1.7841 WP_002213054.1.78556 WP_002213054.1.79515 WP_002213054.1.79550 WP_002213054.1.79609 WP_002213054.1.79825 WP_002213054.1.79981 WP_002213054.1.8009 WP_002213054.1.80331 WP_002213054.1.81848 WP_002213054.1.81877 WP_002213054.1.8210 WP_002213054.1.82133 WP_002213054.1.82151 WP_002213054.1.82270 WP_002213054.1.82436 WP_002213054.1.82619 WP_002213054.1.8303 WP_002213054.1.83039 WP_002213054.1.83265 WP_002213054.1.83630 WP_002213054.1.8420 WP_002213054.1.84703 WP_002213054.1.84720 WP_002213054.1.85269 WP_002213054.1.85270 WP_002213054.1.8559 WP_002213054.1.85802 WP_002213054.1.86034 WP_002213054.1.86059 WP_002213054.1.86413 WP_002213054.1.87107 WP_002213054.1.8728 WP_002213054.1.87418 WP_002213054.1.8762 WP_002213054.1.87853 WP_002213054.1.87988 WP_002213054.1.88362 WP_002213054.1.88472 WP_002213054.1.89359 WP_002213054.1.89542 WP_002213054.1.8964 WP_002213054.1.90176 WP_002213054.1.9051 WP_002213054.1.90624 WP_002213054.1.91263 WP_002213054.1.91373 WP_002213054.1.91844 WP_002213054.1.92030 WP_002213054.1.92331 WP_002213054.1.92604 WP_002213054.1.927 WP_002213054.1.9311 WP_002213054.1.9320 WP_002213054.1.93623 WP_002213054.1.93928 WP_002213054.1.93933 WP_002213054.1.94052 WP_002213054.1.94201 WP_002213054.1.94545 WP_002213054.1.94683 WP_002213054.1.95746 WP_002213054.1.95981 WP_002213054.1.97245 WP_002213054.1.97375 WP_002213054.1.97448 WP_002213054.1.97791 WP_002213054.1.97864 WP_002213054.1.97872 WP_002213054.1.97894 WP_002213054.1.99109 WP_002213054.1.99383 WP_002213054.1.9941 WP_002213054.1.99416 WP_002213054.1.99788 WP_002213054.1.99882 WP_002213054.1.99972 WP_002213054.1.99990 349746.YpAngola_A3208 349747.YpsIP31758_2532 360102.YPA_0736 377628.YPN_2535 386656.YPDSF_1530 502800.YPK_2621 502801.YPTS_1568 gi|170024846|ref|YP_001721351.1| gi|108806733|ref|YP_650649.1| gi|162419961|ref|YP_001607564.1| gi|108812696|ref|YP_648463.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]