SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186895006|ref|YP_001872118.1| from Yersinia pseudotuberculosis PB1/+

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186895006|ref|YP_001872118.1|
Domain Number 1 Region: 7-193,223-374
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 7.33e-99
Family FMN-linked oxidoreductases 0.000000782
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186895006|ref|YP_001872118.1|
Sequence length 381
Comment L-lactate dehydrogenase [Yersinia pseudotuberculosis PB1/+]
Sequence
MIISASTDYRAAAQRKLPPFLFHYIDGGAYNEQTLRRNTADLADIALRQRVLKNMSELSL
ETQLFGETQAMPVVLGPVGLSGMYARRGEVQAARAADKKGIPFTLSTLSVCPIEEVAPAI
ARPMWFQLYVLKDRGFMRNALTRAQAAGVKTLVFTVDMPVPGARYRDAHSGMSGPNAAAR
RLLQAIAHPQWAWDVGLNGKPHDLGNISAYLGKPTTLEDYMGWIATNFDPSISWKDLEWV
REFWQGPMIIKGILDPEDAKDAVKFGADGIVVSNHGGRQLDGVLSTARALPAIADAVKGD
ITILADSGIRTGLDVVRMIALGADSVLLGRAFVYALATAGEAGVINLLTLIEQEMRVAMT
LTGAKRIADINRDSLAVSERG
Download sequence
Identical sequences A0A0E1NQW4 A0A0M1V386 A0A0U1EQX0 A0A151D2J1 A0A208RXQ8 A4TKI4 A7FJF0 A9R623 B1JPU0 B2JZQ1 Q1C9P0 Q1CGZ1 Q66C32 Q8ZFV8
gi|22126477|ref|NP_669900.1| gi|384126011|ref|YP_005508625.1| gi|153950600|ref|YP_001401378.1| gi|384121988|ref|YP_005504608.1| gi|45441280|ref|NP_992819.1| 187410.y2596 214092.YPO1569 229193.YP_1457 273123.YPTB1578 349746.YpAngola_A1696 349747.YpsIP31758_2409 360102.YPA_0864 377628.YPN_2411 386656.YPDSF_1407 502800.YPK_2506 502801.YPTS_1692 gi|108806861|ref|YP_650777.1| gi|145598693|ref|YP_001162769.1| gi|384140545|ref|YP_005523247.1| gi|186895006|ref|YP_001872118.1| gi|384415056|ref|YP_005624418.1| gi|218928707|ref|YP_002346582.1| gi|162418459|ref|YP_001606191.1| WP_002211919.1.100083 WP_002211919.1.100246 WP_002211919.1.100593 WP_002211919.1.10066 WP_002211919.1.100921 WP_002211919.1.100931 WP_002211919.1.10105 WP_002211919.1.101305 WP_002211919.1.101382 WP_002211919.1.101928 WP_002211919.1.102012 WP_002211919.1.102067 WP_002211919.1.10736 WP_002211919.1.10935 WP_002211919.1.10955 WP_002211919.1.11693 WP_002211919.1.12167 WP_002211919.1.12463 WP_002211919.1.12736 WP_002211919.1.12857 WP_002211919.1.1388 WP_002211919.1.14063 WP_002211919.1.14169 WP_002211919.1.14804 WP_002211919.1.15321 WP_002211919.1.15555 WP_002211919.1.15605 WP_002211919.1.15689 WP_002211919.1.16243 WP_002211919.1.16333 WP_002211919.1.17135 WP_002211919.1.17141 WP_002211919.1.17608 WP_002211919.1.17873 WP_002211919.1.17983 WP_002211919.1.18208 WP_002211919.1.18640 WP_002211919.1.18826 WP_002211919.1.19329 WP_002211919.1.19425 WP_002211919.1.19739 WP_002211919.1.19763 WP_002211919.1.20035 WP_002211919.1.20380 WP_002211919.1.2064 WP_002211919.1.20932 WP_002211919.1.21486 WP_002211919.1.21784 WP_002211919.1.21879 WP_002211919.1.21934 WP_002211919.1.22530 WP_002211919.1.22542 WP_002211919.1.22708 WP_002211919.1.23157 WP_002211919.1.23687 WP_002211919.1.23811 WP_002211919.1.24002 WP_002211919.1.2451 WP_002211919.1.24517 WP_002211919.1.25181 WP_002211919.1.25394 WP_002211919.1.26383 WP_002211919.1.2640 WP_002211919.1.26776 WP_002211919.1.26960 WP_002211919.1.27124 WP_002211919.1.27251 WP_002211919.1.2726 WP_002211919.1.28647 WP_002211919.1.28922 WP_002211919.1.29157 WP_002211919.1.29186 WP_002211919.1.29355 WP_002211919.1.29622 WP_002211919.1.2964 WP_002211919.1.29685 WP_002211919.1.29814 WP_002211919.1.3092 WP_002211919.1.30931 WP_002211919.1.311 WP_002211919.1.31336 WP_002211919.1.31496 WP_002211919.1.31721 WP_002211919.1.31739 WP_002211919.1.31805 WP_002211919.1.32343 WP_002211919.1.32388 WP_002211919.1.32446 WP_002211919.1.32736 WP_002211919.1.33203 WP_002211919.1.33324 WP_002211919.1.33661 WP_002211919.1.33775 WP_002211919.1.33937 WP_002211919.1.34031 WP_002211919.1.34138 WP_002211919.1.35389 WP_002211919.1.35538 WP_002211919.1.36088 WP_002211919.1.37174 WP_002211919.1.37494 WP_002211919.1.38147 WP_002211919.1.38235 WP_002211919.1.38532 WP_002211919.1.38743 WP_002211919.1.38824 WP_002211919.1.38993 WP_002211919.1.39066 WP_002211919.1.39346 WP_002211919.1.3976 WP_002211919.1.39858 WP_002211919.1.40071 WP_002211919.1.40134 WP_002211919.1.40534 WP_002211919.1.40853 WP_002211919.1.41196 WP_002211919.1.4210 WP_002211919.1.42361 WP_002211919.1.42490 WP_002211919.1.44408 WP_002211919.1.44598 WP_002211919.1.44603 WP_002211919.1.44832 WP_002211919.1.45198 WP_002211919.1.45214 WP_002211919.1.46262 WP_002211919.1.46545 WP_002211919.1.46686 WP_002211919.1.46697 WP_002211919.1.46731 WP_002211919.1.4678 WP_002211919.1.46891 WP_002211919.1.47387 WP_002211919.1.47440 WP_002211919.1.47769 WP_002211919.1.47881 WP_002211919.1.48166 WP_002211919.1.48722 WP_002211919.1.4889 WP_002211919.1.49906 WP_002211919.1.4997 WP_002211919.1.50010 WP_002211919.1.50093 WP_002211919.1.50106 WP_002211919.1.50185 WP_002211919.1.50984 WP_002211919.1.51284 WP_002211919.1.51293 WP_002211919.1.51588 WP_002211919.1.51772 WP_002211919.1.51934 WP_002211919.1.52158 WP_002211919.1.52247 WP_002211919.1.52734 WP_002211919.1.52792 WP_002211919.1.52819 WP_002211919.1.52969 WP_002211919.1.53147 WP_002211919.1.53300 WP_002211919.1.53838 WP_002211919.1.53883 WP_002211919.1.53953 WP_002211919.1.54568 WP_002211919.1.54951 WP_002211919.1.55194 WP_002211919.1.55695 WP_002211919.1.5592 WP_002211919.1.56031 WP_002211919.1.56953 WP_002211919.1.57585 WP_002211919.1.57657 WP_002211919.1.58067 WP_002211919.1.58543 WP_002211919.1.58794 WP_002211919.1.59102 WP_002211919.1.59431 WP_002211919.1.5957 WP_002211919.1.59635 WP_002211919.1.5968 WP_002211919.1.59687 WP_002211919.1.59789 WP_002211919.1.59885 WP_002211919.1.60437 WP_002211919.1.60707 WP_002211919.1.60896 WP_002211919.1.61689 WP_002211919.1.62232 WP_002211919.1.62342 WP_002211919.1.6270 WP_002211919.1.6333 WP_002211919.1.63387 WP_002211919.1.63641 WP_002211919.1.64142 WP_002211919.1.64474 WP_002211919.1.64780 WP_002211919.1.64786 WP_002211919.1.64910 WP_002211919.1.653 WP_002211919.1.65400 WP_002211919.1.65554 WP_002211919.1.6570 WP_002211919.1.65706 WP_002211919.1.65718 WP_002211919.1.6581 WP_002211919.1.66118 WP_002211919.1.66546 WP_002211919.1.66616 WP_002211919.1.67404 WP_002211919.1.67850 WP_002211919.1.6791 WP_002211919.1.68361 WP_002211919.1.68371 WP_002211919.1.68753 WP_002211919.1.68855 WP_002211919.1.69018 WP_002211919.1.69316 WP_002211919.1.69951 WP_002211919.1.70117 WP_002211919.1.70171 WP_002211919.1.70319 WP_002211919.1.70377 WP_002211919.1.70726 WP_002211919.1.7083 WP_002211919.1.7169 WP_002211919.1.71744 WP_002211919.1.72280 WP_002211919.1.72440 WP_002211919.1.72486 WP_002211919.1.7402 WP_002211919.1.74131 WP_002211919.1.74310 WP_002211919.1.74577 WP_002211919.1.74738 WP_002211919.1.75169 WP_002211919.1.75173 WP_002211919.1.7518 WP_002211919.1.75208 WP_002211919.1.75337 WP_002211919.1.75407 WP_002211919.1.75636 WP_002211919.1.75689 WP_002211919.1.75821 WP_002211919.1.76555 WP_002211919.1.76670 WP_002211919.1.77387 WP_002211919.1.77429 WP_002211919.1.77569 WP_002211919.1.77691 WP_002211919.1.78004 WP_002211919.1.7841 WP_002211919.1.78556 WP_002211919.1.79515 WP_002211919.1.79550 WP_002211919.1.79609 WP_002211919.1.79825 WP_002211919.1.79981 WP_002211919.1.8009 WP_002211919.1.80331 WP_002211919.1.81848 WP_002211919.1.81877 WP_002211919.1.8210 WP_002211919.1.82133 WP_002211919.1.82151 WP_002211919.1.82270 WP_002211919.1.82436 WP_002211919.1.82619 WP_002211919.1.8303 WP_002211919.1.83039 WP_002211919.1.83265 WP_002211919.1.8420 WP_002211919.1.84703 WP_002211919.1.84720 WP_002211919.1.85269 WP_002211919.1.85270 WP_002211919.1.8559 WP_002211919.1.85802 WP_002211919.1.86034 WP_002211919.1.86059 WP_002211919.1.86413 WP_002211919.1.87107 WP_002211919.1.8728 WP_002211919.1.87418 WP_002211919.1.8762 WP_002211919.1.87853 WP_002211919.1.87988 WP_002211919.1.88362 WP_002211919.1.88472 WP_002211919.1.89359 WP_002211919.1.89542 WP_002211919.1.8964 WP_002211919.1.90176 WP_002211919.1.9051 WP_002211919.1.90624 WP_002211919.1.91373 WP_002211919.1.91844 WP_002211919.1.92030 WP_002211919.1.92331 WP_002211919.1.927 WP_002211919.1.9311 WP_002211919.1.9320 WP_002211919.1.93623 WP_002211919.1.93928 WP_002211919.1.93933 WP_002211919.1.94052 WP_002211919.1.94201 WP_002211919.1.94545 WP_002211919.1.94683 WP_002211919.1.95746 WP_002211919.1.95981 WP_002211919.1.97245 WP_002211919.1.97375 WP_002211919.1.97448 WP_002211919.1.97791 WP_002211919.1.97864 WP_002211919.1.97872 WP_002211919.1.97894 WP_002211919.1.99109 WP_002211919.1.99383 WP_002211919.1.9941 WP_002211919.1.99416 WP_002211919.1.99788 WP_002211919.1.99882 WP_002211919.1.99972 WP_002211919.1.99990 YP_002346582.1.25044 gi|170024731|ref|YP_001721236.1| gi|108812572|ref|YP_648339.1| gi|294503542|ref|YP_003567604.1| gi|51595915|ref|YP_070106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]