SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186895558|ref|YP_001872670.1| from Yersinia pseudotuberculosis PB1/+

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186895558|ref|YP_001872670.1|
Domain Number 1 Region: 48-276
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 0.00000114
Family FMN-linked oxidoreductases 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|186895558|ref|YP_001872670.1|
Sequence length 309
Comment hypothetical protein YPTS_2252 [Yersinia pseudotuberculosis PB1/+]
Sequence
MTKKRLLDCCASDFVSMDNAELLYAIRASEGRVMVSETIAITQPLLNNVTNAELAASQGA
DILLINMFDCENPQIQGLPADIAPQHILHELQRLTGRVIGVNLEAVDPEFAVAHNDIWRM
KPGRAATAENARKLVAMGAKILVLTGNPNNGVSNHALGMAVRDIRDAVKDKAVIIAGKMH
GAGVVQESGSHIVSEEDIIWFASQGADIVLLPAPGTVPGMSQQRVASLVDTAHGHGVLAM
TAIGTSQEGADTHTIRQIALMSKMAGADLHHIGDTGYMGIALPENILAYSIVIRGVRHTY
ARVARSINR
Download sequence
Identical sequences A0A0H3B4M0 A0A0U1EL76 Q66AE8
gi|186895558|ref|YP_001872670.1| gi|51596508|ref|YP_070699.1| WP_011192471.1.10066 WP_011192471.1.20380 WP_011192471.1.20932 WP_011192471.1.24517 WP_011192471.1.26383 WP_011192471.1.32736 WP_011192471.1.33324 WP_011192471.1.39858 WP_011192471.1.41984 WP_011192471.1.42361 WP_011192471.1.46697 WP_011192471.1.47881 WP_011192471.1.50185 WP_011192471.1.52473 WP_011192471.1.52792 WP_011192471.1.53147 WP_011192471.1.53883 WP_011192471.1.63641 WP_011192471.1.6791 WP_011192471.1.75208 WP_011192471.1.86059 WP_011192471.1.99882 273123.YPTB2182 502800.YPK_1990 502801.YPTS_2252 gi|170024227|ref|YP_001720732.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]