SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186895672|ref|YP_001872784.1| from Yersinia pseudotuberculosis PB1/+

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186895672|ref|YP_001872784.1|
Domain Number 1 Region: 1-365
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 2.05e-124
Family FMN-linked oxidoreductases 0.000000000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186895672|ref|YP_001872784.1|
Sequence length 365
Comment N-ethylmaleimide reductase [Yersinia pseudotuberculosis PB1/+]
Sequence
MKTAKLFSPLKVGALTLPNRVFMAPLTRLRSIEPGDIPTPLMAEYYRQRASAGLTITEAT
QISFQAKGYAGAPGLHTQEQLNAWKKVTQGVHNEGGHIAVQLWHVGRISHNSLQPGQQAP
VAPSAIAADTRTTVRDETGAWVRVPCSTPRALETEEIPGIINDFRQATANAREAGFDYIE
LHAAHGYLLHQFMSPASNQRTDQYGGSIENRTRLTLEVVDATAAEWGADRIGIRISPLGP
FNGLDNGEDQEEAALYLIDQLNKRNIAYLHISEPDWAGGKPYSDTFRAAVRAHFNGVIVG
AGAYSAEKAECLIQKGFIDAVAFGRSYISNPDLVTRLQQHAPLNEPDSNTFYGGGAKGYT
DYPTL
Download sequence
Identical sequences A0A0U1ENH6 Q66A39
gi|51596617|ref|YP_070808.1| 273123.YPTB2293 502801.YPTS_2366 WP_011192525.1.20932 WP_011192525.1.26383 WP_011192525.1.32736 WP_011192525.1.33324 WP_011192525.1.46697 WP_011192525.1.50185 WP_011192525.1.53883 WP_011192525.1.63641 WP_011192525.1.6791 WP_011192525.1.75208 gi|186895672|ref|YP_001872784.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]