SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186896228|ref|YP_001873340.1| from Yersinia pseudotuberculosis PB1/+

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|186896228|ref|YP_001873340.1|
Domain Number - Region: 23-176
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 0.0879
Family FMN-linked oxidoreductases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|186896228|ref|YP_001873340.1|
Sequence length 464
Comment peptidase U32 [Yersinia pseudotuberculosis PB1/+]
Sequence
MSSSSFTTERPFTPELLSPAGTLKNMRYAFAYGADAVYAGQPRYSLRVRNNEFNHENLAL
GIQEAHALGKRFYVVVNIAPHNSKLKTFLRDLKPVIEMGPDALIMSDPGLIMMVRDAFPQ
MDIHLSVQANAVNWATVKFWQQMGLTRVILSRELSLEEIAEIRAQVPEMELEVFVHGALC
MAYSGRCLLSGYINKRDPNQGTCTNACRWEYNVQEGKEDDVGNIVHIHQPIAVKNVEPTL
GIGAPTDKVFVIEEAQRPGEYMTASEDEHGTYIMNSKDLRAIQHVERLTQLGVHSLKIEG
RTKSFYYCARTAQVYRRAIDDAVAGKPFDPSLLTTLEGLAHRGYTEGFLRRHVHEEQQTY
EYGYSVSERQQFVGEFTGVRREGLAEVLVKNKFSRGDSVELMTPKGNIQFTLESMQDKKG
QPADIAPGNGHIMYLPIPEEIDVEYGLLIRNLNGTNSRNPHEKA
Download sequence
Identical sequences A0A0E1NNJ4 A0A0H2W6H2 A0A0H2YHJ5 A0A0H3B172 A0A0M1VAT2 A0A0U1ETW1 A0A208S1W1 A0A2A7VI14 Q668C0 Q7CJL2
gi|384413838|ref|YP_005623200.1| gi|45442494|ref|NP_994033.1| 187410.y1379 214092.YPO2855 229193.YP_2721 273123.YPTB2820 349746.YpAngola_A3096 360102.YPA_2294 377628.YPN_1283 386656.YPDSF_2205 502800.YPK_1325 502801.YPTS_2926 gi|162420643|ref|YP_001607460.1| WP_002209798.1.100083 WP_002209798.1.100246 WP_002209798.1.10066 WP_002209798.1.100921 WP_002209798.1.10105 WP_002209798.1.101305 WP_002209798.1.101382 WP_002209798.1.101928 WP_002209798.1.102012 WP_002209798.1.102067 WP_002209798.1.10736 WP_002209798.1.10935 WP_002209798.1.10955 WP_002209798.1.11693 WP_002209798.1.12463 WP_002209798.1.12736 WP_002209798.1.12857 WP_002209798.1.1388 WP_002209798.1.14063 WP_002209798.1.14804 WP_002209798.1.15321 WP_002209798.1.15605 WP_002209798.1.15689 WP_002209798.1.16243 WP_002209798.1.16333 WP_002209798.1.17135 WP_002209798.1.17141 WP_002209798.1.17608 WP_002209798.1.17873 WP_002209798.1.17983 WP_002209798.1.18208 WP_002209798.1.18640 WP_002209798.1.18826 WP_002209798.1.19329 WP_002209798.1.19425 WP_002209798.1.19739 WP_002209798.1.19763 WP_002209798.1.20380 WP_002209798.1.20547 WP_002209798.1.2064 WP_002209798.1.20932 WP_002209798.1.21486 WP_002209798.1.21784 WP_002209798.1.21879 WP_002209798.1.21934 WP_002209798.1.22542 WP_002209798.1.23157 WP_002209798.1.23271 WP_002209798.1.23687 WP_002209798.1.23811 WP_002209798.1.24002 WP_002209798.1.2451 WP_002209798.1.24517 WP_002209798.1.25181 WP_002209798.1.26383 WP_002209798.1.2640 WP_002209798.1.26776 WP_002209798.1.26960 WP_002209798.1.27124 WP_002209798.1.27251 WP_002209798.1.2726 WP_002209798.1.28647 WP_002209798.1.28922 WP_002209798.1.29157 WP_002209798.1.29186 WP_002209798.1.29355 WP_002209798.1.29622 WP_002209798.1.29685 WP_002209798.1.29814 WP_002209798.1.30931 WP_002209798.1.311 WP_002209798.1.31336 WP_002209798.1.31496 WP_002209798.1.31739 WP_002209798.1.31805 WP_002209798.1.32343 WP_002209798.1.32446 WP_002209798.1.32736 WP_002209798.1.33203 WP_002209798.1.33324 WP_002209798.1.33661 WP_002209798.1.33937 WP_002209798.1.34031 WP_002209798.1.34138 WP_002209798.1.35389 WP_002209798.1.35538 WP_002209798.1.36088 WP_002209798.1.37174 WP_002209798.1.37494 WP_002209798.1.37863 WP_002209798.1.38235 WP_002209798.1.38743 WP_002209798.1.38824 WP_002209798.1.38993 WP_002209798.1.39066 WP_002209798.1.39346 WP_002209798.1.3976 WP_002209798.1.39858 WP_002209798.1.40071 WP_002209798.1.40134 WP_002209798.1.40534 WP_002209798.1.40853 WP_002209798.1.41196 WP_002209798.1.4210 WP_002209798.1.42361 WP_002209798.1.42490 WP_002209798.1.42976 WP_002209798.1.44408 WP_002209798.1.44832 WP_002209798.1.45198 WP_002209798.1.45214 WP_002209798.1.46262 WP_002209798.1.46545 WP_002209798.1.46686 WP_002209798.1.46697 WP_002209798.1.46731 WP_002209798.1.4678 WP_002209798.1.46891 WP_002209798.1.47387 WP_002209798.1.47440 WP_002209798.1.47881 WP_002209798.1.48722 WP_002209798.1.49315 WP_002209798.1.49906 WP_002209798.1.4997 WP_002209798.1.50010 WP_002209798.1.50093 WP_002209798.1.50185 WP_002209798.1.50984 WP_002209798.1.51284 WP_002209798.1.51293 WP_002209798.1.51588 WP_002209798.1.51772 WP_002209798.1.51934 WP_002209798.1.52158 WP_002209798.1.52247 WP_002209798.1.52734 WP_002209798.1.52792 WP_002209798.1.52819 WP_002209798.1.52969 WP_002209798.1.53147 WP_002209798.1.53300 WP_002209798.1.53838 WP_002209798.1.53848 WP_002209798.1.53953 WP_002209798.1.54568 WP_002209798.1.54951 WP_002209798.1.55194 WP_002209798.1.5592 WP_002209798.1.56031 WP_002209798.1.56912 WP_002209798.1.57585 WP_002209798.1.57657 WP_002209798.1.58067 WP_002209798.1.58794 WP_002209798.1.59102 WP_002209798.1.59431 WP_002209798.1.5957 WP_002209798.1.59635 WP_002209798.1.5968 WP_002209798.1.59687 WP_002209798.1.59789 WP_002209798.1.59885 WP_002209798.1.60437 WP_002209798.1.60707 WP_002209798.1.60896 WP_002209798.1.62232 WP_002209798.1.62342 WP_002209798.1.6270 WP_002209798.1.63387 WP_002209798.1.63641 WP_002209798.1.64142 WP_002209798.1.64474 WP_002209798.1.64780 WP_002209798.1.64786 WP_002209798.1.64910 WP_002209798.1.653 WP_002209798.1.65400 WP_002209798.1.65554 WP_002209798.1.6570 WP_002209798.1.65706 WP_002209798.1.65718 WP_002209798.1.6581 WP_002209798.1.66118 WP_002209798.1.66546 WP_002209798.1.66616 WP_002209798.1.67404 WP_002209798.1.6791 WP_002209798.1.68361 WP_002209798.1.68371 WP_002209798.1.68753 WP_002209798.1.68855 WP_002209798.1.69018 WP_002209798.1.69316 WP_002209798.1.69951 WP_002209798.1.70117 WP_002209798.1.70171 WP_002209798.1.70319 WP_002209798.1.70377 WP_002209798.1.70417 WP_002209798.1.70726 WP_002209798.1.7083 WP_002209798.1.7169 WP_002209798.1.71744 WP_002209798.1.72280 WP_002209798.1.72440 WP_002209798.1.72486 WP_002209798.1.7402 WP_002209798.1.74131 WP_002209798.1.74310 WP_002209798.1.7518 WP_002209798.1.75208 WP_002209798.1.75337 WP_002209798.1.75636 WP_002209798.1.75689 WP_002209798.1.76555 WP_002209798.1.76670 WP_002209798.1.77295 WP_002209798.1.77387 WP_002209798.1.77429 WP_002209798.1.77569 WP_002209798.1.77691 WP_002209798.1.78004 WP_002209798.1.7841 WP_002209798.1.78556 WP_002209798.1.79550 WP_002209798.1.79981 WP_002209798.1.8009 WP_002209798.1.80331 WP_002209798.1.81848 WP_002209798.1.81877 WP_002209798.1.8210 WP_002209798.1.82133 WP_002209798.1.82151 WP_002209798.1.82436 WP_002209798.1.82619 WP_002209798.1.8303 WP_002209798.1.83039 WP_002209798.1.83265 WP_002209798.1.8420 WP_002209798.1.84703 WP_002209798.1.84720 WP_002209798.1.85269 WP_002209798.1.85270 WP_002209798.1.8559 WP_002209798.1.85802 WP_002209798.1.86034 WP_002209798.1.86059 WP_002209798.1.87107 WP_002209798.1.8728 WP_002209798.1.87418 WP_002209798.1.8762 WP_002209798.1.87853 WP_002209798.1.87988 WP_002209798.1.88362 WP_002209798.1.88472 WP_002209798.1.89359 WP_002209798.1.8964 WP_002209798.1.90176 WP_002209798.1.9051 WP_002209798.1.90624 WP_002209798.1.91373 WP_002209798.1.91844 WP_002209798.1.92030 WP_002209798.1.92331 WP_002209798.1.92604 WP_002209798.1.927 WP_002209798.1.9311 WP_002209798.1.9320 WP_002209798.1.93928 WP_002209798.1.94052 WP_002209798.1.94201 WP_002209798.1.94545 WP_002209798.1.94683 WP_002209798.1.95981 WP_002209798.1.97245 WP_002209798.1.97375 WP_002209798.1.97448 WP_002209798.1.97791 WP_002209798.1.97864 WP_002209798.1.97894 WP_002209798.1.99109 WP_002209798.1.99383 WP_002209798.1.9941 WP_002209798.1.99788 WP_002209798.1.99882 WP_002209798.1.99972 WP_002209798.1.99990 YP_002347791.1.25044 gi|384139266|ref|YP_005521968.1| IDP00220 gi|186896228|ref|YP_001873340.1| gi|170023567|ref|YP_001720072.1| gi|108811446|ref|YP_647213.1| gi|51597136|ref|YP_071327.1| gi|145599477|ref|YP_001163553.1| gi|218929916|ref|YP_002347791.1| gi|22125278|ref|NP_668701.1| gi|108808288|ref|YP_652204.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]