SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|186896985|ref|YP_001874097.1| from Yersinia pseudotuberculosis PB1/+

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|186896985|ref|YP_001874097.1|
Domain Number 1 Region: 433-1187
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.05e-252
Family FMN-linked oxidoreductases 0.00000000000344
Further Details:      
 
Domain Number 2 Region: 12-428
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.63e-150
Family Class II glutamine amidotransferases 0.0000000136
Further Details:      
 
Domain Number 3 Region: 1210-1464
Classification Level Classification E-value
Superfamily Alpha subunit of glutamate synthase, C-terminal domain 1.83e-89
Family Alpha subunit of glutamate synthase, C-terminal domain 0.000000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|186896985|ref|YP_001874097.1|
Sequence length 1485
Comment glutamate synthase subunit alpha [Yersinia pseudotuberculosis PB1/+]
Sequence
MLYDQSQERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGAILADGKTGDGCGLLLQ
KPDRFFRMVAEERGWRLAKNYAVGMMFLSQDEELAKASRRIVEEELQNETLSIVGWREVP
TNPDVLGEIALSSLPRIEQIFVNAPAGWRSRDMERRLFVARRRIEKRISDKDFYACSFSN
LVTIYKGLCMPADLPRFYLDLADLRLESAICLFHQRFSTNTVPRWPLAQPFRYLAHNGEI
NTIAGNRQWAKARAYKFKTPLIPDLQDAAPFVNETGSDSSSLDNMLELFLSGGMDLIRAM
RLLVPPAWQNNPDMDTDLRAFFDFNSMHMEPWDGPAGIVMSDGRYAACNLDRNGLRPARY
VITKDKLITCASEVGIWDYQPDEVVEKGRVGPGELMVIDTRSGKILHSAETDNDLKSRHP
YKEWMEKNVKRLVPFEDLPEEQVGSRQLDDSQLETYQKQFGYSNEELDQIIRVLGENGQE
ATGSMGDDTPFAVLSSGPRIIYDYFRQQFAQVTNPPIDPLREAHVMSLATSIGREMNVFC
EAEGQAHRLSFKSPILLYSDFQQLTTLEGEHYRADRLDLTFNPAENDLEQAVLSLCDEAE
RKVRDGAVMLVLSDRAIAPNRLPVPAPMAVGAIQTRLVDKSLRCDANIIVETASARDPHH
FAVLLGFGATAIYPYLAYESLAKLVDSQAIDKKYRDVMLNYRNGINKGLYKIMSKMGIST
VASYRCAKLFEAVGLHRDLSDLCFQGVVSRIGGASFSDFQQDLQNLSKRAWLKRKPLDQG
GLLKFVHNGEYHAYNPDVVSTLQKAVHSGEYSDYQAYAKLVNERPIATLRDLLAIKPQGT
PIPVDQVEPAESLFKRFDTAAMSIGALSPEAHESLAIAMNSLGGFSNSGEGGEDPARYGT
NKVSRIKQVASGRFGVTPAYLVNADVIQIKVAQGAKPGEGGQLPGDKVTPYIAKLRYSVP
GVTLISPPPHHDIYSIEDLAQLIFDLKQVNPKAMISVKLVSEPGVGTIATGVAKAYADLI
TIAGYDGGTGASPLSSVKYAGCPWELGLVETQQALVANGLRHKIRLQVDGGLKTGVDIVK
AAILGAESFGFGTGPMVALGCKYLRICHLNNCATGVATQDEKLRRDHYHGLPERVVNYFH
FIARETREIMAELGVSQLVDLIGRTDMLLELDGISAKQNKLDLSPMLKTATPHPGKALYC
TESNPPFDKGLLNKELLSQAEPYIEAKQSKTFYFDIRNTDRSVGAALSGAIATKHGDQGL
ATDPIKAYFSGTAGQSFGVWNAGGVELMLTGDANDYVGKGMAGGRIAIRPPVGSNFRSHE
ASIIGNTCLYGATGGKLFAAGRAGERFAVRNSGAITVVEGIGDNGCEYMTGGIVCVLGRT
GINFGAGMTGGFAYVLDEDGEFRKRVNPELVEVLDVEQLAIHEEHLRGLITEHVQLTGSS
RGEEILANWPEWVTKFALVKPKSSDVKALLGHRSRSAAELRVQAQ
Download sequence
Identical sequences A0A0U1EWS3
gi|186896985|ref|YP_001874097.1| WP_011193143.1.20932 WP_011193143.1.26383 WP_011193143.1.32736 WP_011193143.1.33324 WP_011193143.1.46697 WP_011193143.1.50185 WP_011193143.1.53883 WP_011193143.1.63641 WP_011193143.1.6791 WP_011193143.1.75208 273123.YPTB3502 502801.YPTS_3687 gi|161760559|ref|YP_071985.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]